KEGG   Aedes albopictus (Asian tiger mosquito): 109415973Help
Entry
109415973         CDS       T06060                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aalb  Aedes albopictus (Asian tiger mosquito)
Pathway
aalb00040  Pentose and glucuronate interconversions
aalb00051  Fructose and mannose metabolism
aalb01100  Metabolic pathways
Module
aalb_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:aalb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    109415973
   00051 Fructose and mannose metabolism
    109415973
Enzymes [BR:aalb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     109415973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 109415973
NCBI-ProteinID: XP_019545497
LinkDB All DBs
Position
Unknown
AA seq 362 aa AA seqDB search
MAKRTNIGAVIHGVDDMRMEQVPIPTPRDNEVLLEIDCVGICGSDVHVLSHGGFGEYVLK
KPMVIGHEASGVVVGVGKAVRRLKVGDRVAIEPAIGCKVCKLCKAGRYNLCPDGIYSATP
PIHGSLQNYYTHPEDCCFKLPPNVTMEEGSLMEPLAVGVHSCRIANVQLGSSVLVLGAGP
IGMVSVLVAKAMGAGKVCVIDLVQSKLDIAKEIGADYTLLIQKGDKEDDIVKKIHGLMGC
APDISIECTGAEPCVRLAILATELGGVVTLVGIGHTNMNLPITIALVREVEIRSGFRYAN
AYPAALAMVANGTIDATRLITHHFNLEDSVQAFKTARHGLEGAIKVMIHCQPRNKNNPMK
KL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaagaacaaacatcggcgcggtgatccacggcgttgacgatatgcgaatggag
caagtcccgataccaacgccgcgcgataacgaagtcctgctggagatcgactgcgtggga
atatgcggatcggatgtgcacgtcctttcccacggtggattcggcgagtacgtcctgaag
aagcccatggtcattgggcacgaggcgtccggtgtggtggtcggtgtcggtaaggccgtt
aggcgtctcaaagtaggtgatcgagtcgcgatagaaccggccattggctgcaaggtgtgc
aaactgtgtaaggccggtcggtacaacctctgtccggatggaatctacagcgctacgccg
ccgatccacggatcgctgcaaaactactatacgcacccggaagattgctgcttcaagtta
ccgccgaatgtgacgatggaggagggatcgctaatggaaccacttgccgtgggggtgcac
agctgtcggattgcaaatgtacagttgggatcgagcgttctggttctcggagccggtcca
atcggaatggtatccgtgctggtagcgaaggcaatgggggcaggcaaagtttgcgtgatc
gatttggttcaaagcaagttggatattgccaaggagattggcgcagactacacgctattg
atccagaagggtgacaaagaagacgacatcgtcaagaagatccatggcctcatgggatgt
gccccggatatctcgatcgaatgcactggggcggaaccctgcgttcggctggcaattttg
gccacggaactcggaggagtcgtaacattggtaggtatcggtcataccaatatgaatctg
cccattacgatcgcgttggttcgagaggtcgagatacgatccggatttaggtatgcaaac
gcgtatccggcagctctggctatggtggcgaatggaacgatcgacgcaaccaggcttatc
acgcatcacttcaatctggaggattcggtgcaggcgttcaaaacggcccgccacggattg
gagggtgcgatcaaggtcatgatccactgtcaacctcgtaacaaaaataacccaatgaag
aagctgtga

DBGET integrated database retrieval system