KEGG   Aedes albopictus (Asian tiger mosquito): 109424501
Entry
109424501         CDS       T06060                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein
  KO
K20017  Bcl-2 family protein
Organism
aalb  Aedes albopictus (Asian tiger mosquito)
Pathway
aalb04214  Apoptosis - fly
aalb04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:aalb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    109424501
   04215 Apoptosis - multiple species
    109424501
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 109424501
NCBI-ProteinID: XP_019552736
LinkDB
Position
Unknown
AA seq 298 aa
MLSAEAPVSHNHHLLPDRLSAPALTRRKFSFPANLHSTVLHGDPPGSINAGSLQPSSTAS
LARRRLSNVSDVVTRKLSSTIGWKQPVLPSQDIITQGKCLCGQYIRCRLKKSGVFNRKLG
LQRIRSIVGTPTIHVVREVFPALLSVGEELERMYPRVYNGVARQLSRIGRGELKTPETAP
VLLSAIARDLFRSDITWGKVVSLFAIAGGLSVDCVRQGHPDYLPKLIEGVADVIEDELVT
WISENGGWVGLANKVRPPQEEITFTGRCFVGAGLLVCLFIVVFLLKTLGIYMFPNIFT
NT seq 897 nt   +upstreamnt  +downstreamnt
atgctgtcagcagaggctcccgtaagccacaaccaccatctactgccagatcggttgagt
gctccggccctgacacgccgaaaattcagctttccggctaaccttcactcaacggttctg
cacggggatcccccgggttccatcaacgcaggctcattacaaccatccagcacagcatcg
ttagcacggcggcgactcagtaacgtaagcgacgtagtcactaggaaactgtccagcaca
atcggatggaagcaaccagtgctgccatcacaggacatcataacacagggaaaatgcctc
tgcggccagtacatccgatgccggctgaaaaagtccggcgtattcaataggaaacttgga
ctgcaaagaattagaagtattgtcggaacaccgaccattcacgtcgtacgagaagtcttc
ccagcgttgttaagcgttggcgaagagctcgagcggatgtatcctcgggtttacaacggg
gtggcacgtcaacttagccgaatcggacggggcgaactgaagacgcccgaaacagctccc
gtactgcttagcgcaatagcgagggatttgttccggagcgacatcacctggggtaaagtg
gtctcgctgtttgccatcgctggaggcctgtcggtggattgtgttcgccagggacacccg
gactatctgccaaaactgatcgaaggggtggccgacgttatcgaggacgaactcgtgacg
tggatttcagaaaatggaggctgggttggactagcaaacaaagtacgccctccacaggaa
gagataacattcaccggacgttgttttgttggagctggtttgttagtttgtttatttatt
gttgtgtttctgttaaaaactttaggtatatacatgtttccaaatatatttacgtag

DBGET integrated database retrieval system