KEGG   Aedes albopictus (Asian tiger mosquito): 115265620
Entry
115265620         CDS       T06060                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
aalb  Aedes albopictus (Asian tiger mosquito)
Pathway
aalb00230  Purine metabolism
aalb01100  Metabolic pathways
aalb04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:aalb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    115265620
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    115265620
Enzymes [BR:aalb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     115265620
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 115265620
NCBI-ProteinID: XP_029727324
LinkDB
Position
Unknown
AA seq 1168 aa
MDGTTTSTTTETNPAGAANLPTSSVLLPNAVLEKLYQSYALKQKRVAFGCYLAASMLLDL
WAILVPQGQSLEAIVILSVFLVLNIILAVVLRFGGKGRFRGFIWEVAPHAAWLMAIMQLF
VHLFLKGSVTPKDSLGWAVLLIFLVYVTLPVLLKYSGILLGVGSVLTYINAIIGLAKRDN
YFWEQLLANIILLVAATVIGLLNYSLAEAKQRRAFLEAKQGLEVKMLIEEQSAEQERLLL
SVLPEHVAVKMRQDLGSTNSEQFKKIYMSRHENVSILYADIVGFTAISSTYSAQDLVKIL
NELFARFDRLAEKYQQLRIKILGDCYYCISGAPVERPDHAVLCVHMGLSMVKAIKYVQQK
TNSPVDMRVGIHTGAVLAGILGQRQWQFDVYSKDVELANKMESSGKAGRVHLSDKTLSFL
NGEFEVEPAYGEKREEALRIAGLKTYFITKVVKPFCPAEHRMNGSADPKDVVIEPDGPSE
VFHDDDEPKSPADDVEANGGLDEKEKEIAAEDYQVRLRKELVSRDGHREIYKDINALLWF
KSDDIEQAYTRYRQPHSSIPLLAAVVVQLTGITFSYLVLPRTTLHFGIVTPPLVIIIVLV
CISVAESFPKILPAFITLNSKRFNDCVGLRTSTAVVIVLLLGISNAGDMLAASFRTPLHL
NITVTDVSFLPNEMHPSTGCLFPSYFSNFAVLILVAVSIITQLSHLSKIALMVAITAIHC
YINIFNLDEAFRHEDFEIMNVFPLRYTLSALLVAVTIALSLLARHIDKVDRVIFMWKTEV
SDQKERASDMRRRNEALVYNVLPMHVAEHFMGNRKRSHDELYSQSYAEVGVLFASMPNFS
DFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDVIKIKTIGSTYMAASGLNPSRIV
KPEDSISVRWAHLALLVEFALELKKALQGINEQSFNHFVLKMGVNHGPITAGVIGARKPH
YDIWGNTVNVASRMESTGKAGAIQVTEETCHILQTFGYTFEQRGLVAVKGKGQLMTYYLQ
GKVPKNASPILPVTTMETVQEVDEPKESPPALPTESPAHQITSVSSSTTSPNSVRLNQEY
VEMKVSSTSNTETSNHHQQHQSVEQQQANSTTVVSTGDQILDGGGVKVLFNGEPEEADVK
TPLLDDKNSTNANHFSEGEKDALIENSN
NT seq 3507 nt   +upstreamnt  +downstreamnt
atggatggaaccacaacctcgacgacaacggaaaccaacccggcgggagcagccaatctg
ccgacctcgagcgtactactgccgaacgctgtgctcgaaaagctctaccagagctacgca
ctcaagcagaagcgggtcgctttcgggtgctatctggcggcctcgatgctgcttgattta
tgggccatcctggtgccgcaaggtcagagcttggaagctatagtgatactgagcgtgttc
ctggtgctgaatattatcctggcagtggtgctgcgcttcggcggaaagggtcgcttccgg
gggttcatctgggaggtggcaccgcacgcagcctggctgatggcaatcatgcaactgttt
gtgcacctgttcctgaaaggatccgttacaccgaaagattccctcggatgggctgtgctc
cttatttttttagtgtacgtaaccctgccggtgctgctcaagtattccggcatcctgctg
ggagttgggtcggtgctcacctatatcaacgccatcattgggctggccaagagggataac
tatttttgggagcagctacttgcaaatatcatcctgctggtggcagcaacggtcatcggg
ttgctgaactactctctggctgaagcgaaacaacgaagagcttttctcgaagcgaaacaa
ggcctagaggtgaagatgctgatcgaagagcagtcagccgaacaggaacgtttgctcctc
tcggtactgccggagcacgtcgccgtgaaaatgcgacaagatctgggatccaccaactcg
gagcagttcaagaaaatctacatgagtcgccacgaaaacgtcagtattctgtatgctgac
atagttggcttcaccgccatctcgtcgacctactcggcccaggatctggtgaaaatatta
aacgaacttttcgcacgattcgatcgtctggcagagaaataccagcaattaaggataaag
atcctgggcgattgctactactgcatcagcggggctcccgtagaacggccggaccacgcc
gtcctctgcgtccacatgggactgtcgatggtgaaggcaatcaaatacgtccagcagaag
accaattcccccgttgacatgcgagtgggaatccacaccggagccgtgctggcgggaatc
ctcggtcagcggcagtggcagttcgatgtttactccaaggatgtggaactggccaacaag
atggaatccagcggaaaggccggccgggttcacttgtcggataaaacgttgagcttcctg
aacggagagtttgaggtggagccggcgtacggcgagaagcgagaggaagcacttcggata
gctgggctaaagacatactttattaccaaagtggtgaaaccgttctgccccgccgagcac
cgaatgaacggctccgccgatcccaaggatgtcgttatcgaaccggatgggccgtcggaa
gtatttcacgatgacgacgaacccaagtctccggcagacgacgtcgaagccaacggcggc
ctggacgagaaggaaaaggaaatcgccgccgaagactaccaggtgcggctccggaaggag
ctggtcagccgcgatggccatcgggaaatctacaaggacatcaacgcgctgctttggttc
aagagcgacgacatcgagcaggcctacacacggtaccggcagccgcacagttccattccg
ctgctggcggcggtggtggtgcaactgaccggaattaccttctcctacctggtgcttccg
cgtacaacgctacactttggtattgttaccccaccgctggtgataattatcgtcttggtg
tgtatctcggtggcagaaagttttccaaagattctgccagcatttatcacgttgaacagt
aaacgatttaacgactgtgtcggcttacgcacatcaacggcagtggttatcgtactgctg
ttaggaatatccaatgccggcgatatgctggcagcttccttccggactccgctgcacctg
aacatcaccgtcaccgacgtgtccttcctgccgaacgagatgcacccgtcgaccggttgt
ttgtttccgtcgtacttcagcaactttgccgtgctgatcctggtggccgtttccatcatc
acgcagctgtcgcatctgagcaaaattgcattaatggttgccattaccgccatccactgc
tacatcaatatattcaacttggacgaagcgttccgacacgaggatttcgagataatgaat
gtatttcccttgcgatatacgctgtcggcgttgttggtggcagtgacgatagcgctttcg
ctcctggcgcggcatatcgacaaagtggaccgggtaatcttcatgtggaaaaccgaagtc
agcgaccagaaggaacgggccagtgacatgcgccggcggaacgaggccctggtgtacaac
gtgctgccgatgcatgtggccgagcatttcatgggcaaccggaagcgttcgcacgacgag
ttgtactcgcagagttacgccgaggtgggtgtgctgtttgccagcatgcccaacttttcc
gacttctactcggaggaaacggtcaacaaccaggggttggagtgtttgcgcttcctgaac
gaggtcatatcggactttgatgcgctcctcgagttgcctcagttccaagacgttatcaaa
atcaagacaatcggatcgacctacatggcagcgagcggattgaacccatcgcgaatcgtc
aaaccggaggattccatttcggtccgatgggcgcatctggccctgctagtggagtttgcc
ctggagttgaagaaggctcttcaaggaatcaacgaacaatcatttaaccattttgtactg
aagatgggcgtcaatcatgggccaatcacggcaggtgtcattggtgccaggaagcctcac
tacgacatctggggcaacacggtgaatgtggcctcccggatggagagtaccgggaaagcg
ggagccattcaggtcaccgaggaaacctgccacattttgcaaaccttcggctacaccttc
gagcagcgaggcctggtggccgtgaagggcaaaggccaactgatgacgtactacctgcag
ggcaaggtcccgaaaaatgcttccccaatacttccggtgacaacgatggaaacggtccag
gaagtggatgaacccaaggaatctccaccggcgcttccaaccgaatccccagcccaccaa
atcacgtcggtttcttccagcaccaccagtcccaacagcgttcgcctaaaccaagagtac
gtagagatgaaggtaagcagtacatcgaacaccgaaacttcgaaccaccatcagcaacat
cagtctgtggagcagcagcaggcaaacagtaccaccgtggtcagtacgggggaccagatt
ttggacggcggcggtgttaaagtgttgttcaatggggaacccgaggaggcagatgtgaaa
actcccctgctcgacgataagaacagcacaaatgcaaatcactttagcgagggtgagaag
gatgcactaatagagaatagcaattag

DBGET integrated database retrieval system