KEGG   Arenibacter algicola: AREALGSMS7_00105Help
Entry
AREALGSMS7_00105  CDS       T04973                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
aalg  Arenibacter algicola
Pathway
aalg00380  Tryptophan metabolism
aalg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aalg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AREALGSMS7_00105 (kynU)
Enzymes [BR:aalg01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AREALGSMS7_00105 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DUF1134 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ASO03603
UniProt: A0A221UQS1
LinkDB All DBs
Position
complement(109644..110915)
Genome map
AA seq 423 aa AA seqDB search
MEFKNSLVFAQQLDAVDPLRKYRDEFHFPKVKGKDVIYFTGNSLGLQPKRTQKFVDDIMK
DWKDLAVEGHFHAEKPWWDYHERLAAPLAKVVGAKTPEVSVMNTLTVNLHMLMVSFYRPT
EKRFKIICEEKAFPSDQYMLNSQVEFHGFDTNTAIVEVKKRPGENFWHTQDVIDKINEVG
EELALVLIGGVNYYNGQVFNMEAITKAAKAQGAFVGWDLAHGVGNVELKLHDWGVDFAAW
CSYKYMNSGPGNASGIFVHEKYLNNNEIPRFEGWWGTKKETRFLMKPEFEPMENADAWQV
SNPPVLSLAPYLASLEMFDEVGMEALISKRNLIVAYLEFILQEIDKETEGSFEIITPKDR
GCQLSVFLHGQGKDLFNYLMDNGVITDWREPNVIRLAPAPFYCSFADMYNFGQILKSGIL
AKG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaaaaattcgttagtgtttgcccaacaattggatgcggtggatccccttagg
aaataccgtgacgaattccattttcctaaagtaaagggcaaagatgttatttatttcacc
ggaaattccctgggattacagcctaaacgcacccaaaagtttgtagatgacataatgaag
gattggaaggatctggcggtggaaggtcatttccatgctgaaaaaccttggtgggattat
catgagcggttggcagcgcccttggcaaaagtagtaggagccaagacgccggaagtttcc
gttatgaataccttgaccgttaaccttcacatgctgatggtgtctttttataggcctacg
gaaaagagatttaagattatttgcgaggaaaaagcatttccttccgatcaatatatgttg
aacagccaggttgaatttcatggtttcgataccaataccgctattgtggaagtgaagaaa
aggccgggcgaaaatttttggcatacccaagatgttatcgataaaattaatgaagttggg
gaagaactggccttagtgctcattggcggcgttaattactacaatggtcaggtctttaat
atggaagccataaccaaggcggccaaggcacaaggagcattcgtaggatgggatttggcg
catggggtaggtaatgtggaattaaaactgcacgattggggggtcgactttgcagcttgg
tgcagttacaaatatatgaacagtggtccggggaatgcttccgggatttttgttcacgag
aaatatctgaataacaacgagattcccagatttgaaggctggtggggaacaaagaaagag
accaggtttttaatgaaaccagagtttgaacctatggaaaatgcggatgcatggcaggta
agcaatcctccagtactttcccttgctccttatttggcctctttggaaatgttcgatgaa
gtgggtatggaggccctgatttccaaaagaaatctcattgtggcttatttggagtttatt
ctccaggaaatagacaaggagaccgaagggtctttcgaaattattaccccaaaggacagg
ggctgtcaactttccgtgtttttacacgggcaggggaaggatttgttcaattatctaatg
gataatggcgttattacagattggcgcgaacccaacgtaattcggctggcacctgcacct
ttttattgttcctttgccgatatgtacaactttggtcaaattcttaaatccggcatcctg
gcaaagggctag

DBGET integrated database retrieval system