KEGG   Arenibacter algicola: AREALGSMS7_01211Help
Entry
AREALGSMS7_01211  CDS       T04973                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
aalg  Arenibacter algicola
Pathway
aalg00240  Pyrimidine metabolism
aalg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aalg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AREALGSMS7_01211 (tdk)
Enzymes [BR:aalg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AREALGSMS7_01211 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ASO04686
UniProt: A0A221UUB0
LinkDB All DBs
Position
1405180..1405824
Genome map
AA seq 214 aa AA seqDB search
MFLENTVNPKEQFGWIEVICGSMFSGKTEELIRRLKRAKFAKQKVEIFKPMVDKRYHEEM
VVSHDANEIRSTPVPAAANIRLLADDCDVVGIDEAQFFDDEIVTVCNDLANKGIRVVVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKANNNKLVFLGETEEYEP
LSRAAYYKAMLKEKVSAIEVTSEEVLPPQKKSND
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatactgttaaccctaaagaacaattcggttggatcgaagtaatctgc
ggttccatgttctctggcaagaccgaggaacttatccgaaggttaaaaagagccaaattt
gccaagcaaaaggtagagattttcaagcctatggtagacaaaagataccacgaggaaatg
gtagtctcccacgatgccaatgaaattagatctaccccggttccggcagctgccaatatt
cgacttttggcagatgactgtgatgtggtagggattgatgaggcccaattcttcgatgac
gaaattgttaccgtttgcaacgatctggcaaataagggtatccgagtggttgtagcagga
ttggacatggatttcaaaggcaatccgttcggacctatgcctgccttgatggcaacggcc
gaatatgtcacaaaagttcatgccgtttgtacacggaccggcaatcttgccaattatagt
tttagaaaggccaataacaacaaattggtttttctgggagaaacggaagaatacgaaccc
ctaagtagagctgcgtactacaaagccatgttaaaagaaaaagtgagtgccatagaagtt
acatccgaggaagtattacctcctcaaaaaaaatcgaatgactaa

DBGET integrated database retrieval system