KEGG   Arenibacter algicola: AREALGSMS7_02208Help
Entry
AREALGSMS7_02208  CDS       T04973                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
aalg  Arenibacter algicola
Pathway
aalg00020  Citrate cycle (TCA cycle)
aalg00310  Lysine degradation
aalg00380  Tryptophan metabolism
aalg01100  Metabolic pathways
aalg01110  Biosynthesis of secondary metabolites
aalg01120  Microbial metabolism in diverse environments
aalg01130  Biosynthesis of antibiotics
aalg01200  Carbon metabolism
Module
aalg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aalg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aalg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AREALGSMS7_02208 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    AREALGSMS7_02208 (sucA)
   00380 Tryptophan metabolism
    AREALGSMS7_02208 (sucA)
Enzymes [BR:aalg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AREALGSMS7_02208 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ASO05663
UniProt: A0A221UWN5
LinkDB All DBs
Position
2590331..2593141
Genome map
AA seq 936 aa AA seqDB search
MDKYSFLNAAHTSYFAELYDKYLINPDSVEPSWRAFFQGFDFGMENSMDGMVDELQTAPL
SVAGGHEVEVPEKLQKEFQVVRLIDGYRTRGHLFTKTNPVRERRQYFPTLEIGNFGLAPS
DLDTTFTAGEILGIGPSTLREIIQHLTSIYCDAIGVEYMYIRNPERVEWIQNWLNVNDNH
PKYDADRKKHILKKLNEAVSFEGFLHTKYVGQKRFSLEGNESLIPALDAVVEKAAEMGVE
QFVMGMAHRGRLNVLTNIFGKKAKDIFSEFDGKDYEQEIFDGDVKYHLGWTSERKANNGK
KIIMNIAPNPSHLETVGAVVEGIARAKQDARYKDDFSKVLPIVVHGDAAIAGQGLVYEVV
QMANLDGYKTNGTIHIVVNNQIGFTTNYLDARSSTYCTDVAKVTLSPVLHVNSDDPEAVV
HASLFALEFRMRFQRDVFLDLLGYRKYGHNEGDEPRFTQPKLYKAIAKHKNSRDIYAAAL
IKEGIIGDGFVQELEEQYKASLEEELEDSRKEDKTVITPFMADEWSGYTHVREWEMMDPV
DTKYDKKKLTDIAKVLTELPKNKKFLRKVEKLVNDRKAMFFENDTLDWAMGELLAYGTLL
EEGYGVRMSGQDVERGTFSHRHAVMKVEESEEEVMLLNHISDKQGTFQIYNSLLSEYGVV
GFDYGYAMASPNTLTIWEAQFGDFSNGAQIMIDQYISAAEDKWKLQNGLVMLLPHGYEGQ
GAEHSSARMERYLQLCARDNMYIADVTTPANMFHLLRRQMKVNFRKPLIVFTPKSLLRHP
RAVSTVEEFANGEFQTVIDDATAEVSKIKSMVFCTGKFYYDLLAYKEENNREDVALVRVE
QLFPVPTKQMKAIMDKYKNAEDKVWAQEEPRNMGAWGHLTMHFSEAHKLRVASRRFYASP
AAGSAVRSKRRHQQVIDYVFDINKNNMGRNPESTDN
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggataaatattcctttttaaacgctgcgcatacttcttatttcgcagaattatacgat
aagtatttaataaatcccgatagtgtagagcctagttggagggccttttttcaagggttt
gattttggcatggaaaattccatggatgggatggtcgatgaattgcagacggcaccattg
tctgtggctggtggtcacgaggtagaggttccggagaaacttcagaaggagtttcaggta
gttcgactcatagatgggtacaggactagagggcatttgtttaccaaaacaaacccagtg
agggagagaagacagtatttccccactttggaaattgggaattttggccttgctccaagc
gatttggataccacatttaccgcaggggaaattttgggaataggcccaagcaccttgcgt
gaaattatacagcaccttacaagcatatattgtgatgccattggggtggaatatatgtat
atcagaaacccggagagggtggaatggatccaaaattggttgaatgtcaatgacaatcat
cccaaatacgatgccgacaggaaaaagcatattcttaaaaaattaaatgaggcggtttcc
ttcgaaggattcctgcacaccaaatatgtgggtcaaaagaggttttctttggaaggaaat
gaatcgttgataccggcattggatgcggtagtggaaaaagctgccgaaatgggggtggag
caatttgttatgggtatggcccataggggccgcttgaatgttcttaccaatatatttggc
aagaaggcaaaggatatctttagtgagttcgatggtaaggattatgagcaggagattttt
gatggggatgtgaaataccatttggggtggacttctgaacggaaagccaacaatggaaaa
aaaataataatgaatattgcgccaaacccttcccacttggagactgttggtgcggtagtt
gaaggtatcgccagggcaaagcaggatgctcgttataaagacgatttttccaaggtattg
cctattgtagtgcatggtgatgctgccattgcagggcagggattggtttatgaagtggtg
caaatggcaaatttggatggttataaaaccaatggtaccattcatattgttgtaaataat
caaattgggtttactaccaattatttggatgcccgtagctctacttattgtacggacgtg
gccaaggtaaccttgagtccggtgctacatgttaattcggacgatccggaggcagttgta
catgcctcgctatttgccttggaatttcgtatgcgttttcaaagggatgtatttttagat
cttttggggtataggaaatatgggcataacgaaggtgatgagccgcgttttacccagcca
aaactctataaagcaattgccaagcataaaaactcgagggacatttatgctgcagcattg
attaaggaaggtattataggggacggttttgtgcaagagttggaagaacaatataaagct
tctttggaggaggaattggaagattccagaaaagaagataagaccgtgataacccccttt
atggccgatgaatggagcgggtatacccatgtgcgcgagtgggagatgatggatccggtg
gatacaaaatatgataaaaagaaacttacggatatagccaaggtgttgacagagttgccc
aagaataagaagttcttgcgcaaagttgagaaattggtgaacgatcgcaaggctatgttt
tttgaaaatgataccttggattgggccatgggagagcttttggcctacggtactcttttg
gaggaaggttacggggtgcgtatgtccggacaggatgttgaaagaggtactttttcacac
cgccatgccgtaatgaaagtagaagaaagtgaggaggaagtaatgcttttaaaccacatt
tcggataaacagggaacttttcaaatatataattcacttttatcggaatatggtgtagtt
ggttttgattatggatacgctatggcgagccccaataccttaacgatttgggaagctcaa
tttggggattttagcaatggtgcccagattatgatagatcagtacatatccgctgcggag
gataaatggaaattacagaatggtttggtaatgctgttgccgcacgggtacgaaggtcag
ggcgcagaacattcgtccgcccgtatggagcgctatttacaattatgtgcaagggataat
atgtatatcgccgatgtaactacccctgcaaatatgttccatctgttgagaaggcaaatg
aaggtgaatttcaggaagcctttaatagtgtttacaccaaaaagtttgttgaggcatcca
cgggccgtatcaacggttgaggaatttgcaaatggggaatttcaaacggtaattgatgat
gcaaccgctgaggtgtccaaaattaagagcatggtattctgtaccggtaaattctattac
gaccttttggcttataaggaggaaaataatagggaagacgtagccttggtaagggtggaa
caattgtttccggtgccgacaaagcaaatgaaggcaataatggataaatataaaaatgcc
gaagacaaggtttgggcacaggaggaaccgaggaatatgggtgcttggggtcatttaacc
atgcatttcagcgaggcacataaattaagggtagcctccagaagattttacgcatcccca
gcagccggtagtgcagtgcgttccaagcgtcgtcatcagcaggtaatagattatgttttt
gatataaacaaaaacaatatgggaagaaacccggagtctactgataattag

DBGET integrated database retrieval system