KEGG   Arenibacter algicola: AREALGSMS7_02849Help
Entry
AREALGSMS7_02849  CDS       T04973                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
aalg  Arenibacter algicola
Pathway
aalg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aalg01100  Metabolic pathways
aalg01110  Biosynthesis of secondary metabolites
aalg01130  Biosynthesis of antibiotics
aalg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aalg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AREALGSMS7_02849
Enzymes [BR:aalg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     AREALGSMS7_02849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ASO06287
UniProt: A0A221UY49
LinkDB All DBs
Position
3317755..3318936
Genome map
AA seq 393 aa AA seqDB search
MSHYKPIEQSFKVAYEYKLHFTENIFSLHNPLFKDIINGYNNKGDVKVLFVIDSGVLACH
PNLKADITSYCTQNSSAIHLTEQLVIAGGEQCKNDYHNVERILNAVNDNRICRHSFVVAI
GGGAIIDMVGYAAAIAHRGVKLIRIPSTVLSQNDSAVGVKNSFNILGKKNFLGTFAPAYA
IINDSNFLTTLEQRDWISGIAEAVKVALIKDAVFFDFIEENSALLQARDMESMEYLIYRC
AEMHMEHIAQGGDPFESGSSRPLDFGHWAAHKLEYMTNYQLRHGEAVAIGMALDLVYAHF
IGLISEETLDRILKVLEHIGFDLHIPIQKDSDLEDLLNGIQEFREHLGGELTITLISKIG
TKHDVHEIDISTMEKAIVWLNEMYKPKVSNTTC
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcacattataaaccaatagagcaatcctttaaagtagcttatgagtataagctacat
tttacggaaaatatttttagtttgcataaccccttgttcaaggatattattaatgggtac
aacaataagggggatgtaaaagtgctatttgttatagatagtggtgtactggcctgccat
ccaaatttaaaggcggatattacttcctattgcacacaaaatagttcagcgatacatcta
acggaacaattggtgattgctggaggggaacaatgcaagaatgattaccacaatgtggag
cggatattgaatgccgttaatgacaatcgcatttgcaggcattcttttgttgtagccatt
gggggaggtgccattattgatatggtgggatatgctgccgccatcgcccataggggggtg
aagttgataagaattccttctacagtactctcccagaacgattcggccgttggggtgaag
aatagttttaatattttaggtaaaaagaattttctgggaacttttgctccagcttatgcc
ataataaacgacagtaattttttaaccaccttggagcagcgcgattggatttcagggata
gccgaggcggtaaaagtggctttgataaaggatgcggtattctttgattttattgaagag
aacagtgccttgcttcaggcacgtgatatggagtctatggagtacctgatttatcgctgt
gcggagatgcatatggagcatattgcccaagggggggatccctttgaaagtggttcttcc
agacctctggattttggccattgggcagcccataaattggaatacatgaccaattatcaa
ctgagacatggggaagctgtagccattggcatggccttggatttggtatatgcccatttt
atagggttgataagtgaggaaacactggaccgcattttaaaggttctggaacacattgga
ttcgatttacatattcctattcaaaaggatagtgatctggaggatctgttaaacggcatt
caggaatttagggagcatttgggcggggagcttactatcaccttgatatccaaaataggt
accaaacacgatgtacacgaaattgatatttccaccatggaaaaagcaatagtatggttg
aacgaaatgtataaacctaaagtatcgaataccacatgttaa

DBGET integrated database retrieval system