KEGG   Alternaria alternata: CC77DRAFT_1005624Help
Entry
CC77DRAFT_1005624 CDS       T05291                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
aalt  Alternaria alternata
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aalt03036]
    CC77DRAFT_1005624
Enzymes [BR:aalt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CC77DRAFT_1005624
Chromosome and associated proteins [BR:aalt03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CC77DRAFT_1005624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl Abhydrolase_3 COesterase DUF2974
Motif
Other DBs
NCBI-GeneID: 29108958
NCBI-ProteinID: XP_018390086
JGI: 1005624
UniProt: A0A177DY49
LinkDB All DBs
Position
Unknown
AA seq 1576 aa AA seqDB search
MNIDSSTWKEYSREDAEFEALQPHLPPPKSFADYSSAAELRQSFNEQIGQMVAAGIVTFP
DWTGYHKSEIQIPTRDGSSVRSLVIRPEGKEPGPLYVYFAGGGWTFGMPEFGEGMAEMLV
KELGFTVVSVGYRNAPEHVFPTAAHDAIDAVKWTLQCAENAKSLSADPSKGFILGGTSAG
ANLAAVSAHQVVDDNLTPKITGVVLMSVSVCHPKAMPEEYKPHISSWEDHRDSLVLDRRG
MEWFFDNYKPDPKSPLASPLIWKTHEGQPPTYLQVMGTDPLRDEALVYENVLRDIGTPTK
VDVYAGYPHGAPDFFPMLSVAKRALADLKEGLGWILQQRSAFVIARLSSCTLNPSDKRQA
PRHDGLRPASRAYCAKMQNSPRSSPAARPGTPRGARQTNNDANPLSHPLKRLSLHSASNT
PLPQSPALNSPRSSADLRRTPSTPNFKANAVQRSPSVASFRSSTPALGRKSSTSSLRGDP
PRPGTSASRRSSFNPNMQAPMPKSPLGPTYVEEKPPLRACDVAEDYFKKDMARHEGMAGA
VNAGTIVIVHDQCYGHRFSRPKTPKSHLSLIMERPERILASVLGISAAYVRLGERHAEGD
NPPHPHHNPPERIPFKIRKTSRAVDITSQVVTNVHGTKWMGELKSLCDNAERKLASTGKE
LVRDTPAIPGQPPKQQLHAGDLYLCPESLNAFQGALGGVLDAVDAVFQGTSLGSGPSRAF
VCIRPPGHHCSDDFPSGFCWLNNVHVGIEHAMMTYGLTHAAIIDFDLHHGDGSQAITWAR
NKKVQNMPKNTPNWKKTSIGYFSLHDINSYPCEDGDDDKVQAASLCIDNAHGQSIWNVHL
QSWKTPEQFWEIYEEKYLILLEKTRQYLKHHTNRLRASPNHPAPKAAIFLSAGFDASEWE
TAGMQRHSVNVPTEFYARFTRDAVRLAEEEGTSVEGRVISVLEGGYSDRALTSGVFSHLS
GLVDGQVWKESEPSKGLASSMRNRLSGLGIQDEDAPMQSVEPELTPVSYDPLWWQANHLS
ELEGLVPPPPVTASKVTRAERLAHFSSPTQSYVAKVVDPTKINRSLSAKYASNPLRAPTP
PPPEVDWATAAHALSSLLIPSDRQTRSFRPEDLAEVKAKKEKPAAPAPAAVHVEKSGRQL
RGRKAAPSYAEPGSDDEKISRQESRASRRQTIADFAPASSEASAPARSASRRMSIASSVS
SIGDNRNVRAPSVAASRRSVAPSVASTNGVAMKKARGSTTTTAAAARAPQRPAVARAPSS
YSVKAGATKGKENDGVDALTSGLKRITLKMPSKEEHDAREKEKAEKQKAAEAPKKTTARK
PPAARAPPTKPTTKPAVTAKRGPGRPAKSSKPASPIPEAPQMQVAAAAPLEQPQPIQTDS
SNILPQPTAPQPFQDAQNPMEPPAVDRRISGGIVQPPTELHDMAITPEQIREQLPMPSFV
TVTEPLSDVSPPSRADTPPPPPPSNISQFVNYTAQSFGGNPDFVTSPPDTSSPQASATLQ
WVANTHAEDTTMPGVPLMSPPSKRADLPVFTANGAIPFASGSNDLENASRPEYPGVGIKN
EEKVRDMWEVPDTPAR
NT seq 4731 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgattcatcaacatggaaggagtatagtagggaagatgcagagtttgaagct
ctacaaccccatcttccaccacccaaatccttcgcagattactcatccgccgctgagctc
cgtcagtcattcaatgagcaaattggccagatggttgcggccggcatcgtgacttttccc
gactggactggttaccacaaatctgaaatccagatccctacgcgcgatgggtcttcagtg
cggtccctcgtgattcgtcctgagggaaaggaaccaggaccgttgtatgtgtatttcgcc
ggcggtggatggacttttgggatgccagagtttggcgagggaatggcagagatgttggtg
aaggaattaggtttcacggtcgtgagcgtagggtatcggaacgcaccagagcatgtcttt
cctactgcggcgcatgacgctattgatgcagtcaaatggactctccagtgtgccgagaac
gcgaagtcgttgagtgcggatccttccaaaggtttcatcctaggagggacttcagctgga
gccaacctagcagctgtatcagcccatcaggttgtcgatgacaacttaaccccgaagatt
actggggtagtccttatgtctgtttcggtatgccatcccaaggccatgcccgaggagtac
aaaccgcacatatcaagctgggaggaccatagagatagtctagtactggaccgccgaggc
atggaatggttcttcgacaactacaaaccagaccccaagtcaccattagcgagcccgctg
atctggaagactcatgaaggccaacctcctacgtatctgcaggtcatggggactgatccc
ttgcgtgacgaagcactggtatacgagaacgttctccgagacattgggacaccaacgaag
gtcgacgtgtatgctggatatccgcatggtgcgcccgacttctttcccatgcttagcgtg
gcgaagagggcgttggctgatttgaaggagggtttgggatggattttgcagcagcgttcg
gccttcgtcatagcgcgcctttcttcttgcaccctcaacccatccgataagagacaggca
ccaagacacgacgggctacgtcctgcatcgcgggcatactgtgccaagatgcagaattca
ccgcggtccagccccgccgccaggcccggcactccgcgaggggcgcgacaaacaaacaac
gacgcgaatcccctttcacaccccctcaaacgcctgtccctgcattccgcctcgaatacc
ccactaccgcagtctcccgctctgaattcacctcgaagttcagctgatctccgccggacg
ccttcgacccccaacttcaaggcgaatgccgtccaacgcagcccaagtgtagcaagtttc
cgctcttcaacacccgccttgggacgcaagtcgtcgacctcttccctccgcggcgaccct
cctcgcccgggcacttctgcatcccgccgctcgtccttcaacccaaatatgcaggcaccc
atgcccaagagcccgctaggccccacgtatgtagaggagaagccaccactgcgcgcatgt
gatgttgccgaagactacttcaagaaggacatggcacggcatgagggtatggcaggcgca
gtcaatgcgggcaccatcgtcatcgtacacgaccaatgctacggccatcgcttttcgcgg
cccaagacacccaagagccacctcagcttgatcatggagcgaccagagaggatactggca
agcgttttgggtatttcagcagcctacgttcgactgggcgagcgccacgccgagggggac
aatccaccgcatccgcatcacaatccgcccgagcgtataccattcaagatccgcaagact
tcccgagcagtcgacatcacctcacaggtcgtcaccaacgtacacggaaccaagtggatg
ggcgagctgaagtcattgtgcgataacgcagagcggaagctggcatcgacagggaaagaa
ctggtcagggacacccctgcaatcccggggcaaccgccgaagcaacaactacatgctggg
gatctatacctctgccccgaatcgctaaacgccttccagggggctcttggaggtgttttg
gatgcggtggatgctgtcttccaggggaccagccttggtagcggcccctcccgagctttc
gtctgtatccgcccgcctggccatcactgctccgacgactttccctccggattctgctgg
ctgaataacgttcacgttggtatcgaacacgccatgatgacatacggcctcacgcacgca
gccatcattgactttgatctgcatcacggagatggctcgcaagctataacatgggcgcgc
aacaaaaaggttcagaacatgcccaagaatacacccaactggaagaagacttcgatcggc
tacttcagtctacacgacatcaactcgtacccttgcgaagacggtgatgacgacaaagtt
caggccgctagtctgtgtatcgacaacgcacacggccagtccatctggaacgtgcatctg
cagtcttggaagacaccggagcaattctgggaaatttacgaagagaagtacctgatactg
ctcgagaaaacacgccagtatctcaaacatcacaccaaccgcctccgggcttcaccaaat
caccctgcgcccaaagcagccatcttcttatctgctggctttgacgcgagcgagtgggaa
actgccggcatgcaacgacacagtgtcaacgtacctaccgaattctacgctcgattcacc
cgcgatgcagtacgcttggccgaagaggagggtacgtctgtggagggtcgtgtcatctct
gtcctagaaggcggttacagcgaccgagcacttaccagtggcgtgttcagtcatttgagc
ggtcttgtggatggtcaagtctggaaggagtcagaaccatcaaagggcctcgcctcctcc
atgcgaaacagactgagtggacttggtatccaggatgaagacgctcccatgcaatctgtc
gagccagaactcacacccgtcagttatgatcctctgtggtggcaggcaaatcatctatct
gagctggagggcctcgttcctccaccgcctgtaactgcctcaaaggtgacccgcgctgag
cgcctggcccatttctcctcacccacacagtcctacgtcgccaaagtcgtggatccaaca
aagatcaatcgtagtctttccgccaaatacgcttccaatccattgagagcgcccacgcca
ccgccgccagaggttgactgggctaccgctgcacatgctttgagtagtttgctaattccc
tctgatcgtcaaacccgcagtttcaggccagaagatctagcagaagtaaaagcaaagaaa
gagaagcccgctgcacctgccccagcggcggttcatgttgaaaagtcgggacgtcaattg
cgtggtcgtaaagctgctccatcttacgctgagcctggatccgacgacgaaaagatatct
cgtcaagagtcacgagccagtaggcgccagacgattgccgacttcgcaccagccagttca
gaagcttcggcgccagcacgctctgcttcccgtcgcatgagtatcgcttccagcgtctca
tcaataggagacaacagaaatgttcgtgcgccaagtgtagcggcaagccgaaggagcgtt
gcaccttctgtagcttcaactaatggagtggctatgaagaaggcaagaggatcaacaaca
acgactgctgcggcagctcgcgcccctcagcgtccggcagtagcaagagcgccttccagc
tattctgtcaaggctggtgcgaccaagggaaaggagaacgacggcgtcgatgcactcact
tcaggcctgaagcgcatcacgttgaagatgccctcgaaggaggagcatgatgcacgagag
aaggagaaggctgagaagcaaaaggccgctgaagcaccaaagaagactactgcacggaaa
ccaccagctgctcgcgctcctcccacaaaaccgacgactaaacctgcagtgactgctaag
aggggacctggtcggccagcaaagtcgtcgaaacctgcatcgcctatccctgaggcccca
cagatgcaagttgctgctgctgcacctctcgaacaaccccagccaatacagacagactcg
tctaatatcctaccacagcctactgcgccacagcctttccaggatgcacaaaatccgatg
gagcctccagctgtagatcgacgtatttctggtggaatcgtgcagccacccaccgagttg
catgatatggctataacaccggaacagatccgtgaacaactccctatgccgtcctttgtc
actgtaacggagccactctcggatgtctcaccaccttctcgtgccgatacgcctcctccc
ccaccaccgtcaaatatttctcagttcgtcaactacacggcgcagagcttcggtggaaac
ccagactttgtaacctcgccaccggacacctcaagcccacaggcgtccgcaactttacaa
tgggttgccaatacacacgctgaggacacgaccatgcctggtgtcccgctcatgtcaccg
ccaagcaagagggctgatctacctgtattcacagcgaacggtgcgataccgtttgcatca
ggctcgaatgacttggaaaacgcgtctaggcctgagtaccctggtgtaggtatcaagaac
gaggagaaggtcagggacatgtgggaggtccctgatacgcccgctcgctag

DBGET integrated database retrieval system