KEGG   Alternaria alternata: CC77DRAFT_1006863Help
Entry
CC77DRAFT_1006863 CDS       T05291                                 

Definition
(RefSeq) hypothetical protein
Organism
aalt  Alternaria alternata
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 29109039
NCBI-ProteinID: XP_018388945
JGI: 1006863
UniProt: A0A177DUZ0
LinkDB All DBs
Position
Unknown
AA seq 1097 aa AA seqDB search
MRAARYYGKEDIRIEDVEEQKCGAGQVRVAPAFVGICGTDLHEYLGGPNFAPTTPHPCTN
ETIPITLGHEFSGTVTEVGSDDSGFTVGQNVVVQPTIYCGKCNACTAGSENVCENGGFIG
LSGGGGGLSDSVVVPEGAVLNLPSNVPLDVGALVEPLGVAWHAVSAAPLTPDSVVMILGG
GPIGLAIVQCLVALGTKKIIMSEVSGARQRFAREFGAHHVLCPKTYDVVKMSKALSGRDG
PDVVFDCAGVPASLTTACTAVRARGTVVNVAIWEKEVPFNPNMLVFREAQYTAVLGYQRK
DLEAVIEHLAAGTLKPMNMITRKISLEDLVEDGIKTLINDKENHVKILARRVAAKRRIRY
GAADAHLPWPALGAASGRLLSTGEALCSRSRAHRIHLVATMVQYNPMPSPGPYVPPGQGT
PAQQQGAQQPPSYQPNATTYGGPNQSQKGVAGFGQMMNQRLEQAVTTGKPMLNKLGKTIS
SKLGNKPPGGPPQHLQSYHNYQSHYGQQNQTQSYQQPQGQAFSPQSQSQQWGQQQHQPPS
QTPTAYPSSQQSPHQQFNNQTPVSGHSAQNNYFPQQTSQAPNYQSYAPQSPLAGTTQTAW
QYGKEQTQAQGQNGQGQAPPGQPQVHGHSQYAGQQMGVAGGSYVTQHTPPPHTSSMSPAL
PAQHMQPQWQQPGSSQLPPASTEQQSGILPPPSQQNVSASPPVHTTYQHQWNSPSPVGSQ
GQGQSQTLPHSISPPPTHQTIASPQVPPNKPVQSSDAAPHSTPTEFIAELPAELPADVGS
LSLVESKPQEAVSGSQYQAFRPPVSQNGSPSPGFTIPRRSLSASTVPVADPWRFVDPATE
VPTREFYILADLLFDALDRKFEPRNTGLLEAPKIIGSWVKLTEDACRLFSYRSYSAFAKL
WSLEGIPHMMVPCQPDLAPNWNFNQHSHAQDVKVTGQVPTATTGYTTYMPALNRAGWYKF
FFLEVTHAPEDIDDLIPALCADTYKPGMLNQPDLDKRDKTDVPALRARAAEIQTYAIGRV
CEETKVAMAVDPDVPLAHTHPTATAWGGAQTSAEDMADMAVRMHKIQSERQQNDMAAWTM
LGMQPKGYPGGGYGSLV
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcacgatactacgggaaagaagatatccggattgaagatgtggaggagcaa
aagtgtggtgcgggacaagtcagggtcgccccggccttcgtaggtatctgcggtaccgat
ctccatgaatacctcggcggacctaacttcgcaccgacgacaccgcacccgtgtacgaat
gaaaccattcccatcaccttgggacatgagttctcggggactgttacggaagtgggatcg
gatgattcgggctttaccgtgggccaaaacgttgttgtccagccgacgatatattgcggg
aagtgcaatgcatgcacagctggctccgagaatgtatgcgagaacggcggcttcatcggg
ctttcgggaggaggtggtggcttgagcgactccgttgttgtgcctgagggtgcggtacta
aacttgcccagtaacgtaccgcttgatgtcggcgcgctggtagaacctcttggtgtcgca
tggcatgctgtctccgctgctccactgacaccagattccgtcgtcatgattctaggtggt
ggaccaattgggctcgcaattgtccaatgtttggtggcactaggcacaaagaagattatc
atgagcgaggtatccggcgcacggcagcgcttcgcgagagaatttggtgctcatcacgtt
ctttgccctaagacgtacgatgttgtcaagatgagcaaggcgcttagtggtagggatggg
ccggatgtggttttcgattgcgctggggtaccagcaagtctcacgaccgcctgcacagca
gtaagggctcggggcacggtcgtcaatgtcgcgatctgggagaaagaggtgcctttcaac
cccaacatgcttgtgttccgagaggcgcagtacacagccgtcttgggctatcaaagaaag
gacctcgaggcggttatcgaacatctcgctgctggtaccttgaagcctatgaatatgatt
acgcgcaagattagtctagaggatctagtagaagacgggattaaaaccttgatcaacgac
aaggagaaccatgtcaagattctggctcgacgggtcgccgccaagcgtcgtatacggtac
ggtgcggctgatgctcatctgccgtggccagccttgggcgcagcatcgggacgtctcttg
tctacaggagaagcactctgctcacgttcgagggctcaccgaattcaccttgtagccacc
atggtgcaatacaacccaatgccttcgccagggccctatgtccctccgggtcaaggcact
ccagcacagcagcaaggcgcccagcagccaccaagctatcagcccaatgcaacgacttac
ggaggaccaaatcaatctcagaaaggagttgccggattcggccagatgatgaatcagcgg
ctagagcaggcggtcacaacgggcaagccaatgctgaacaagctgggcaagactataagc
tcaaagctaggaaacaagcctccaggaggcccaccccagcatctccagagctaccataac
taccagagccattacggacagcagaaccagacccaatcgtaccagcaacctcagggtcaa
gccttcagtccccagtcgcaatcgcagcaatggggccaacagcagcatcaacccccatct
caaacaccgaccgcttacccctcctcgcagcagtctccacaccagcagttcaacaaccag
acgcccgtgtcaggtcactcggcacagaacaattatttcccacaacagacgagtcaagcg
cccaactaccaatcttacgcgccgcaatcgccgctcgctggcactacacaaacagcctgg
caatatggtaaggagcagacgcaggcacaaggacaaaacggacaggggcaggctccgcca
ggtcagcctcaggtacatgggcacagccaatatgctggacagcagatgggcgtagctgga
ggctcgtatgtcactcaacatacaccacctcctcatacttcgagcatgtctccggcgtta
cctgctcagcacatgcagccacagtggcaacagccaggtagctcacagctgcccccggca
agtaccgagcagcaatcgggcattctcccgcctccctcacaacaaaacgtttccgcgagt
ccaccggttcatacaacgtatcagcaccaatggaacagcccgtctccagttggctcacaa
ggacagggacaatcgcagacactgcctcattctatcagtcctccacctacgcatcagaca
attgcatcacctcaagtgccgccaaacaagcctgtccagtcaagcgatgcagcaccgcac
tcgacgccaacagagtttatcgcagagcttcctgcggagctcccggcagatgttggaagc
ttgagtcttgtagagtcgaagccgcaagaggctgtttctggttcgcaataccaagccttc
cgtccacccgtgtcgcagaatggatcgccctctcctgggtttacaattcctcgtcgatct
cttagtgccagtacagtaccagttgccgacccatggaggtttgtggatccggcaacagaa
gttccaacacgcgaattctatatcctggcagacttgcttttcgatgctttggatcggaag
tttgagcctagaaacacgggcctcttggaagcaccaaagatcatcggaagctgggtaaaa
ttaacagaagacgcgtgtcgtcttttttcatataggtcctacagcgcgtttgcaaagttg
tggagtcttgaagggatcccacacatgatggtgccctgccaacccgacttggcaccaaac
tggaacttcaaccagcactcgcatgcgcaagacgtaaaagtaacaggtcaagtgccgaca
gccacgacgggctacacgacgtacatgccagctttgaatcgggcgggatggtacaagttc
ttcttccttgaggtgacgcatgcaccagaagacatcgatgatctaataccagcactatgc
gcagatacttacaagccggggatgctgaaccaacccgacctggacaagcgggacaagaca
gacgtccctgcgctacgggctagagctgcggagatacagacgtatgcgattgggcgtgtt
tgtgaggagaccaaggtcgcgatggcggtcgaccccgatgtccctctggcgcacacgcac
ccgactgcgacagcttggggaggcgcgcaaacgtcagcagaagacatggccgacatggct
gtccgtatgcacaagatccagtcggagcggcagcagaacgacatggcggcttggacgatg
ctggggatgcagccgaagggctatccgggcggtggttatggtagtctagtgtag

DBGET integrated database retrieval system