KEGG   Alternaria alternata: CC77DRAFT_1020620Help
Entry
CC77DRAFT_1020620 CDS       T05291                                 

Definition
(RefSeq) glycolipid 2-alpha-mannosyltransferase
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
aalt  Alternaria alternata
Pathway
aalt00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CC77DRAFT_1020620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aalt01003]
    CC77DRAFT_1020620
Enzymes [BR:aalt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     CC77DRAFT_1020620
Glycosyltransferases [BR:aalt01003]
 Glycan extension
  Yeast mannan chain
   CC77DRAFT_1020620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15 EGF_3
Motif
Other DBs
NCBI-GeneID: 29110683
NCBI-ProteinID: XP_018385495
JGI: 1020620
UniProt: A0A177DJF7
LinkDB All DBs
Position
Unknown
AA seq 403 aa AA seqDB search
MAGSQRYIRYIVFAVVALVLLYFIGSSSSVPSASWPVYQDTKSPATPQGNAPVASDDVQQ
VTTPTTPNQQKLPPATIPGDRMNATFVTLARNSDVWEIAESIRQVEDRFNRKFNYDWVFL
NDDDFSDEFKKVTTALVSGTTKYGKIPTEHWSFPEWIDQDKAAKVRETMKEKKIIYGDSI
SYRHMCRYESGFFFRHPLMLDYEWYWRVEPSVKLYCDINYDTFKFMAENKKKYSFTLSLY
EYVETIPTLWDATKNFTKHYPQHIVKDNAMKFLSDDGGETYNHCHFWSNFEIGNLNWLRS
DAYIDFFTSLDHAGGFFYERWGDAPVHSIAAGLLLQKDEIHFFNDIAYYHVPFTHCPTGE
QYRLDHKCSCNPKDNFDWNGYSCTSRFYEMQGMEKPAGYEKEQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggccggcagccagcggtacatccgctacatcgtctttgcggtagtggctctcgtcctc
ctctacttcatcggctcctcctcgtctgtgccttctgcaagctggccagtctaccaggac
acaaagtcgcccgcgactccccagggcaatgctcccgtcgccagcgatgacgtccagcag
gtcacgactcctaccacgcccaaccagcagaagctcccacccgccactatccccggcgac
cgcatgaacgcaacttttgtcaccctcgcccgtaactccgacgtctgggagattgccgag
tccatccgccaagtcgaagaccgcttcaaccgcaagttcaactacgactgggtcttcctc
aacgacgacgacttcagcgacgagttcaagaaggtcaccactgcgctcgtgtccggcacc
accaagtacggcaagattcccacggagcattggtccttccccgaatggatcgaccaggac
aaggccgctaaggttcgcgagaccatgaaggagaagaagatcatctacggcgactccatc
agctacaggcacatgtgccgctacgagtctggcttcttcttccgccaccccttgatgctc
gactacgagtggtactggcgtgtcgagcccagcgtcaagctctactgcgacatcaactac
gacaccttcaagttcatggccgagaacaagaagaagtacagcttcactctcagtctctac
gaatacgtcgagaccatccccaccctctgggatgccaccaagaacttcaccaagcactac
ccccagcacatcgtcaaggacaacgccatgaagttcctcagtgacgacggcggcgagacc
tacaaccactgccatttctggtccaacttcgagattggcaacctcaactggctccgttcc
gacgcatacattgacttcttcacctctcttgaccacgcaggcggtttcttctacgagcga
tggggcgatgcccccgtacactccattgccgcaggtctgctactacaaaaggacgagatc
cacttcttcaacgacattgcctactaccacgtccccttcacgcattgcccgaccggtgag
caataccgcctcgaccacaagtgctcttgcaaccccaaggacaactttgactggaatgga
tacagctgcacatcccgcttctacgaaatgcaaggcatggagaagccagcagggtacgaa
aaggagcagtaa

DBGET integrated database retrieval system