KEGG   Alternaria alternata: CC77DRAFT_1021406Help
Entry
CC77DRAFT_1021406 CDS       T05291                                 

Definition
(RefSeq) Actin, gamma
  KO
K05692  actin beta/gamma 1
Organism
aalt  Alternaria alternata
Pathway
aalt04145  Phagosome
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CC77DRAFT_1021406
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aalt03021]
    CC77DRAFT_1021406
   03019 Messenger RNA biogenesis [BR:aalt03019]
    CC77DRAFT_1021406
   03036 Chromosome and associated proteins [BR:aalt03036]
    CC77DRAFT_1021406
   03029 Mitochondrial biogenesis [BR:aalt03029]
    CC77DRAFT_1021406
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aalt04812]
    CC77DRAFT_1021406
   04147 Exosome [BR:aalt04147]
    CC77DRAFT_1021406
Transcription machinery [BR:aalt03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     CC77DRAFT_1021406
Messenger RNA biogenesis [BR:aalt03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     CC77DRAFT_1021406
Chromosome and associated proteins [BR:aalt03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     CC77DRAFT_1021406
    NuA4 complex
     CC77DRAFT_1021406
  Chromatin remodeling factors
   BAF complex
    CC77DRAFT_1021406
   PBAF complex
    CC77DRAFT_1021406
   SWR1 complex
    CC77DRAFT_1021406
Mitochondrial biogenesis [BR:aalt03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    CC77DRAFT_1021406
Cytoskeleton proteins [BR:aalt04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     CC77DRAFT_1021406
Exosome [BR:aalt04147]
 Exosomal proteins
  Proteins found in most exosomes
   CC77DRAFT_1021406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 29110852
NCBI-ProteinID: XP_018384667
JGI: 1021406
UniProt: A0A177DIB4
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MEEEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIMIGMGQKDSYVGDEAQS
KRGILTLRYPIEHGVVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPINPKSNREKMT
QIVFETFNAPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTHVVPIYEGFALPHAISRVDM
AGRDLTDYLMKILAERGYTFSTTAEREIVRDIKEKLCYVALDFEQEIQTASQSSSLEKSY
ELPDGQVITIGNERFRAPEALFQPSVLGLESGGIHVTTFNSIMKCDVDVRKDLYGNIVMS
GGTTMYPGISDRMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaagtcgcagccctcgtcatcgacaatggttcgggtatgtgcaaggccggt
ttcgccggtgacgatgcgccccgagcagtcttcccttccatcgtcggccgaccgcgtcac
catggtatcatgattggtatgggccagaaggactcatatgtcggtgatgaggcacagtcg
aagcgtggtatcctgaccctgcgataccccattgagcacggtgtcgttaccaactgggac
gacatggagaagatctggcatcacactttctacaacgagctgcgtgttgcccccgaggag
caccccgtcctgctcaccgaggctcccatcaaccccaagtccaaccgtgagaagatgaca
cagattgttttcgagaccttcaacgctcccgctttctacgtctccattcaggccgtcctg
tccctgtacgcctccggacgtaccaccggtatcgttcttgactccggtgacggtgtcact
cacgttgtccccatttacgagggtttcgctcttccccacgccatttcccgtgtcgacatg
gctggtcgtgatctgactgactacctcatgaagatcttggctgagcgcggttacaccttc
tccaccactgccgagcgagaaatcgtccgtgacatcaaggagaagctctgctacgtcgct
ctcgacttcgagcaggagatccagaccgccagccagtcctccagcttggagaagtcctac
gagcttcctgacggtcaagtcatcaccattggcaacgagcgtttccgtgctcctgaggct
ctcttccagccttccgtcttgggtcttgagagcggtggtatccacgtcaccactttcaac
tccatcatgaagtgcgatgtcgacgtcaggaaagacctgtacggcaacattgtcatgtct
ggtggtaccaccatgtaccccggtatctccgaccgtatgcagaaggaaatcaccgccctc
gccccatcctcgatgaaggtcaagatcatcgctcccccggagcgcaagtactccgtctgg
atcggtggttccattcttgcttccctctccaccttccagcagatgtggatctcaaagcag
gagtacgacgagagcggtccctccatcgtccaccgcaagtgcttctaa

DBGET integrated database retrieval system