KEGG   Alternaria alternata: CC77DRAFT_1022835Help
Entry
CC77DRAFT_1022835 CDS       T05291                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
aalt  Alternaria alternata
Pathway
aalt03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CC77DRAFT_1022835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aalt03400]
    CC77DRAFT_1022835
Enzymes [BR:aalt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CC77DRAFT_1022835
DNA repair and recombination proteins [BR:aalt03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     CC77DRAFT_1022835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_N DNA_ligase_A_M BRCT_2 RNA_ligase DNA_ligase_A_C LIG3_BRCT BRCT PTCB-BRCT Bac_globin DNA_ligase_IV
Motif
Other DBs
NCBI-GeneID: 29111143
NCBI-ProteinID: XP_018383382
JGI: 1022835
UniProt: A0A177DFC9
LinkDB All DBs
Position
Unknown
AA seq 994 aa AA seqDB search
MAEDTPMADAEAVRENTLMYGHDDELDDKYPTRPINLHKTLPFHTLFTELFNPLMETQKR
KQPVGARRRVGPHGHSNMSPHEAKRNIIERFIATWRKQVGNDFFPAMRLIIPEKDRDRAM
YGLKEKTIAKVLIKLTRIDPNSDGAKHMLNWKLPGQLNKASASTAGDFAGRCYEILSTRQ
LKTEYSDMSIAEVNNALDKLSQIGAEEEQVKIFQRFYRRMNAEEMTWLIRMVLRQMKIGA
TEKTILDIWHPDAETLFNISSNLRRVCWELFDPEVRLAGEDTGLSLMQCFQPQLAQFQDK
VGNFEKLVTRFQGNTDDDTFWIEEKLDGERMQLHMVEDPDAPGGRTFGFWSRKAKDYAYL
YGKHFQGDEAGALTRFITDAFGKNVRNIILDGEMITWDMDRDHIVGFGTLKTAAISEKEN
KTDKNTGQRPVFRVFDCVFLNDKLLTQYTLRDRRRALESAVKGVHRRLEIHPYTEARSHT
EIEPALRKVVADSSEGLVLKNPRSMYRLNQRNNDWMKVKPEYMSEFGESLDCIVVGGYFG
SGHRGGAHSSFLCALLTNKDAKKGDLKYEHCWSFFKVGGGFAQQDYADIRGRTEGKWHNW
DPRRPPPFIELGGHEHNRQHERPDQWIRPRDSVVLECKAASVEGTDKFRFSLTLRFPRFK
GLKKDKRWDQALSVQEFLEVKSRAETEKSEKEKEFKIEQSRRKKARISKKPLTVVGNDAV
ATPYAGPASKVFEGLSFFIMTEQIHPTKKSKPDLEALVKANGGKIVQRDSMDKDLVIVAD
KRLIKVASLEKRATNNIIKPIWIQDCIKQNEIDCAPLPYLLPFEPNRHMFYLHDDDQLDF
ENNVDEYGDSFARDIADVDDMRKLLAGVGAGSDNDSAFERQGFLDQLEDHGESLAHLKTR
MFGTVKAAFDSNPIDASGMLKAQLSKNYIRFGGGSVTDRIVEEGVTHVVVPNEHSSAKSV
KAKVTGLARIVGVAWVEKCWEEGTMLDEERFQWG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagatacaccaatggccgatgccgaggcggttagggagaacacgctcatgtac
ggccatgatgatgagctcgacgacaagtacccaacacgtccgataaacctccacaaaaca
cttcccttccataccctattcacggaactattcaatccgcttatggaaacacaaaaaagg
aagcagcctgtgggagctcggcgaagagtcggaccacatggacactctaatatgtcacct
cacgaagcgaaacgtaacatcatcgaaagattcattgcgacttggcgcaagcaagtgggc
aatgacttctttcccgcaatgcgtctcataatcccggaaaaggacagagatcgagccatg
tacggtctgaaagagaagacaattgccaaggtcttgatcaaacttacaaggatcgacccc
aactctgacggtgccaaacatatgctgaactggaagctacctggtcagctgaacaaggct
tcggcatcaactgccggcgacttcgctggacgatgctacgagatcctgtcaacccggcaa
ctcaagaccgaatacagcgacatgagtatcgcagaggtcaacaacgctctagataagcta
tcacagattggcgccgaagaagagcaagtcaagatcttccaacggttctatcgaaggatg
aacgctgaggagatgacctggctcattcggatggtccttcgccagatgaagattggagcc
actgagaagaccattctagacatctggcatccagatgcagagacgttattcaacatctct
tcaaaccttcgaagagtgtgctgggaactatttgaccctgaggtccgtctggcaggcgaa
gacactgggctgagcttgatgcaatgcttccagccacaactggctcagtttcaggataag
gtaggtaactttgagaagctggtcacaagatttcaagggaacaccgatgacgataccttt
tggattgaagagaagcttgatggagaacgtatgcagcttcacatggttgaggatcctgac
gcgccaggcggtagaacttttgggttctggtcgcgaaaggccaaagactatgcgtacctc
tacggtaaacacttccaaggcgacgaagctggtgcactcacacggttcataacagacgcc
tttggcaagaatgtgcggaacatcatccttgatggcgagatgatcacctgggatatggac
cgcgatcacattgttgggtttggaactctcaagaccgcagctatatccgagaaagaaaac
aaaacggacaagaacactggtcagcgaccggtcttcagggtttttgactgcgtattcctg
aacgacaagctactcacacaatacacgctacgtgatcgccgtcgcgctctggaaagtgcc
gtcaagggcgtacatcgtcgtctggagatccacccgtacaccgaggcgcgctcgcataca
gagattgaaccagcactacggaaggtcgttgctgattcttcggaaggtctggtgctgaag
aacccacgttctatgtatcggctaaatcaacgcaacaacgattggatgaaagttaagcca
gaatacatgtccgaattcggcgagtcgctcgactgcatagttgtcggcgggtactttggc
tctggacatcgtggtggcgcccactcatcctttctttgcgcactgcttacgaacaaagat
gcaaagaaaggcgacctgaagtacgaacattgttggtcgttcttcaaagttggaggcgga
tttgctcaacaagactatgctgacatacggggccgaacggaaggcaagtggcataattgg
gatcctcgacggccacctccatttattgagttaggcggtcatgagcacaatcgacaacac
gagcgaccagatcaatggatcagacccagagattctgtcgttctggaatgcaaggcagca
agtgtggaaggcaccgacaagtttcgcttctctttaacgcttcgctttcctcgcttcaag
gggctcaaaaaggacaaacgctgggatcaggcactgtcggtacaggaatttctggaagta
aagagcagagctgaaactgagaagtcggaaaaggagaaagaattcaagattgagcaatca
cgcaggaagaaggcgagaatatcgaagaagccactcactgtggtaggtaacgatgccgtt
gctacaccatatgcgggtccagcatcgaaggtatttgagggcctgagctttttcataatg
actgagcaaatccacccaacgaagaagtcgaaacccgatcttgaagcactggtcaaagcc
aacggtggcaagattgtgcagcgcgattcgatggacaaagaccttgtcatcgtagcggac
aagagactgattaaagttgcatcactcgagaaacgcgccacgaacaacatcatcaagcct
atctggatccaggattgcatcaagcagaatgagatagactgtgcccctttaccatacctg
ctcccattcgagccaaaccgacatatgttctacctccacgatgacgatcagctcgacttc
gagaacaatgttgatgagtatggagattcgtttgcgcgcgacatagcagatgtagatgat
atgcgaaagctgttggctggtgtaggagcagggtcagacaacgactcagcatttgaacga
caaggcttcctagaccaactagaagaccacggagagtcacttgcgcatctcaagacacgc
atgtttggcacagtaaaagctgcgtttgacagcaatcctattgatgctagcgggatgctc
aaagcccaactatcgaagaactatattcgattcggcggtggttcagtgactgatcggata
gttgaggaaggagtcacacatgttgttgtaccgaacgaacactcttcggccaagagtgta
aaggctaaggtcactggacttgccaggattgtgggtgtcgcgtgggtagagaagtgctgg
gaggaaggcactatgttggatgaggagcggtttcagtgggggtga

DBGET integrated database retrieval system