KEGG   Alternaria alternata: CC77DRAFT_1025328Help
Entry
CC77DRAFT_1025328 CDS       T05291                                 

Definition
(RefSeq) succinate dehydrogenase flavo protein subunit mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aalt  Alternaria alternata
Pathway
aalt00020  Citrate cycle (TCA cycle)
aalt00190  Oxidative phosphorylation
aalt01100  Metabolic pathways
aalt01110  Biosynthesis of secondary metabolites
aalt01130  Biosynthesis of antibiotics
aalt01200  Carbon metabolism
Module
aalt_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CC77DRAFT_1025328
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CC77DRAFT_1025328
Enzymes [BR:aalt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CC77DRAFT_1025328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 29111642
NCBI-ProteinID: XP_018380410
JGI: 1025328
UniProt: A0A177D7U3
LinkDB All DBs
Position
Unknown
AA seq 647 aa AA seqDB search
MSCLRMRRTQLASQLARSFRPTTRAFSSTRPAQRIFATENLRAKEASGFISSKYPVIDHE
YDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPFSRTDDGKIYQRAFGGQSQKYG
KGGQAYRCCAAADRTGHALLHTLYGQSLRHNTKYFIEFFATDLIMEDGVCKGVVAYNQED
GTIHRFIAKNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPAEVLHERLPGISETAAIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGEV
ITQDAQGNDQVVPGLFACGEAASVSVHGANRLGANSLLDLIVFGRAVSHTIRDNFSPGQK
ADPVSADAGADSISVLDQIRTSDGPKSTAEVRLQMQKVMQTDVAVFRTQESLDEGVKKIH
DVDADFANVGIKDRSMIWNSDLVETLELRNLLTCAVQTAESAANRKESRGAHAREDFPDR
DDEQWMKHTLSWQKKPHGETQLGYRKVVGTTLDEAECKAVPPFKRTY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtctcaggatgcgtcgtacgcagcttgcaagccagctcgcgaggagcttccgc
ccaaccacacgagctttctcttcaacccggccagcgcaacgcattttcgctactgagaac
ctgagggcaaaggaagcgtcgggtttcatttccagcaaataccccgtcatcgaccacgaa
tacgatgccattgttgttggtgctggaggagctggtcttcgcgccgcgttcggtctcgct
gaagctggtttcaacaccgcctgtatatctaagcttttccccacacggtcgcacacagtt
gccgcacagggtggaattaatgctgcgcttggaaacatgcatgaggacgactggcggtgg
catatgtacgacacagtcaagggatccgactggcttggcgaccaggacgccattcactac
atgacaagagaagcgcctcaatctgttatcgaactcgagaattatggttgcccattttcg
cgaacagacgacggcaagatctaccagcgtgctttcggtggacagtcccagaagtacgga
aagggtggtcaagcataccgatgctgtgctgccgctgaccgtaccggccacgctctcctc
cacactctctacggacaatcgctacgacacaacaccaagtacttcatcgagttcttcgcc
acggatctaatcatggaggacggcgtctgcaagggtgttgtcgcatacaaccaggaagac
ggaaccatccaccgattcattgccaagaacactgtattggccactggtggctacggacgt
gcctacttcagctgcacatctgcccacacctgcactggtgacggtatggctatggttgct
cgcgcgggtcttcccaaccaggatctggagttcgtccaattccaccctactggtatctac
ggtgctggctgcttgatcactgagggatcccgcggagagggtggttacctcctcaactct
gagggtgaacggttcatggagcgttacgcgcctactgccaaggatcttgcgtcccgcgac
gtcgtatcgcgatcgatgaccctggaaatccgtgaaggccgtggtgtcggtcctgaaaag
gaccatatctacctccagctcagccatctgcccgccgaggttctccatgagcgtctacct
ggtatttctgagactgccgctatcttcgctggtgtcgatgtcaccaagcagcccatccct
gttctccccacggtccactacaacatgggtggtattcctaccaagtacactggtgaggtc
atcactcaagatgcccaaggtaatgaccaggtcgtcccaggtctgttcgcttgtggtgaa
gctgcctccgtctccgtccacggagccaaccgtcttggtgccaactctctcctcgatctt
atcgtcttcggtcgtgctgtttcccacactatccgcgataacttcagccctggccaaaag
gctgatcccgtctccgctgatgctggtgctgattccatctccgttctcgaccagatccgt
acatctgatggccccaagtcgactgccgaagtccgcctccagatgcagaaggtcatgcag
accgacgttgccgtcttccgaactcaagagtccctcgatgagggtgtcaagaagatccac
gacgtcgacgctgacttcgccaacgttggtatcaaggaccgcagcatgatctggaactcc
gatcttgtcgagaccctcgagcttcgtaacctcctcacttgcgccgttcaaaccgccgaa
tccgccgccaaccgtaaggagtcacgaggtgcccacgcccgtgaggatttccccgaccgt
gacgatgaacaatggatgaagcacacactgtcgtggcagaagaagccccatggtgagacc
caattaggctacaggaaggtcgttggtactactttggatgaggctgagtgcaaggctgta
ccgccgttcaagcgtacgtactag

DBGET integrated database retrieval system