KEGG   Alternaria alternata: CC77DRAFT_1037828Help
Entry
CC77DRAFT_1037828 CDS       T05291                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aalt  Alternaria alternata
Pathway
aalt03030  DNA replication
aalt03410  Base excision repair
aalt03420  Nucleotide excision repair
aalt03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CC77DRAFT_1037828
   03410 Base excision repair
    CC77DRAFT_1037828
   03420 Nucleotide excision repair
    CC77DRAFT_1037828
   03430 Mismatch repair
    CC77DRAFT_1037828
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aalt03032]
    CC77DRAFT_1037828
   03400 DNA repair and recombination proteins [BR:aalt03400]
    CC77DRAFT_1037828
Enzymes [BR:aalt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CC77DRAFT_1037828
    6.5.1.6  DNA ligase (ATP or NAD+)
     CC77DRAFT_1037828
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CC77DRAFT_1037828
DNA replication proteins [BR:aalt03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CC77DRAFT_1037828
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CC77DRAFT_1037828
DNA repair and recombination proteins [BR:aalt03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CC77DRAFT_1037828
   NER (nucleotide excision repair)
    Other NER factors
     CC77DRAFT_1037828
   MMR (mismatch excision repair)
    Other MMR factors
     CC77DRAFT_1037828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 29112684
NCBI-ProteinID: XP_018389836
JGI: 1037828
UniProt: A0A177DXF0
LinkDB All DBs
Position
Unknown
AA seq 881 aa AA seqDB search
MNSPSKRRKKNDGSGKPIRSLDYFFAKQTARATPKDAPTNTGPSKPPVDQDNTGLTDEEL
ARKLQEQWDKEDRQQGSNQEPAEPVNSNELYEEPDKVPADTTQDTKGQNGNSELAIREAT
VENTKAAELNQKKNTLSLQSTASEEDAITANIPFDQSPLEFEPAKYIPELKKHWVNDGGH
ATYALLTRCFILVNSTTSRIRIVDTLVNLIRTIVESDPDSLLPAVWLATNAISPPYIDLE
LGLGGSAISKALKKVCGLDNAGLKVLNAKYGDAGDVAFEAKKKQSFTLRKPKPLTIRSVF
DSLVKIANSKGHGSVENKQRIVERLVQDTRGAEESRYIVRTLVQHLRIGAVKTTMLIALS
RAFMLSKPLGAEFEIRDQKQMAKLKKEELTEAYIRNEEIVKACFARRPNYNDLIPVLLEI
GVCDELLVRCGLSLHIPLRPMLGSITRDMGEMLTKLQGRDFACEYKYDGQRAQVHCDAKG
KVTIFSRHLEVMTDKYPDLVALVPKIRGEGVSSFILEGEVVAVDRESGDLKTFQTLANRA
RKDVVVGAVTIDVCLFAFDLMYLNGEELLNRPFRERRSLLRSLFVEIPHHFTWVKSLDAT
SADVEAVQAFFQSALEIKCEGIMVKILDNLPNPDLLAEIDEAIEKTPSLPPTPKKKKPAK
SKAKSNSNETEKDEPKTSGRRKALLSTYEPDKRLDSWLKVKKDYSTTSETLDLIPIAAFH
GSGRKAAWWSPILLAIRNAETGQLEAVTKCMSGFTDTFYKANRAKYDPDDPDCTNVLSGK
PHYVEYNGGAGMPVVWFEPQEVWEVAFADLTLSPTYTAAIGLVSEERGLSTRFPRFLRVR
EDKGIDEATEAEELASLYRKQEAKAPKKNDAITEVMYEDDE
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtccctccaaacgccggaagaagaatgatggctcagggaagccgatacgcagc
ttggactacttcttcgcaaagcaaacggctagagcgacacccaaagatgcgccaacgaac
acaggtcccagcaaaccgcccgtggatcaggacaacacaggcctgaccgatgaagaactc
gcgcgtaaacttcaggagcagtgggataaggaagaccgacagcaggggtcaaatcaggag
ccggcggagccggtgaactcgaatgaactgtatgaggagcccgacaaagtccctgcagac
acgacacaagacacaaaaggacagaatgggaattccgaattagcaatacgtgaagccact
gtagaaaacacaaaggctgccgaactcaaccagaagaaaaacacgctatctctccaatcg
accgcctccgaagaagacgcgataacagcaaatatacccttcgatcaaagccctctcgaa
tttgaaccggcaaaatacatcccggaactaaagaaacattgggtgaacgacggagggcat
gcgacttacgcgttattgacacgatgtttcattctggtcaacagtacgacaagtcgcatc
agaatagtcgacacgcttgtgaaccttattcgaacgattgtcgaaagcgatcctgatagc
ctgcttccagccgtctggctcgcgacgaatgcgatatcgcccccttacatcgatctggag
cttggtttggggggctcagcgatctcgaaagcacttaagaaagtttgtgggctggataac
gcaggcttgaaagtattgaacgcaaaatatggcgatgctggcgatgtcgcattcgaagca
aagaagaagcagagcttcacccttcgcaaaccgaagcctctgacaatcaggagtgtcttc
gactcactagtcaagatcgcaaacagtaagggacatggcagtgtagagaacaagcagaga
attgtcgaaagactggtgcaggatacacggggtgctgaagaaagccgctacattgtacgg
acgctcgtacagcatctgcggattggagctgtcaagaccacgatgcttatcgctttgtcc
cgtgccttcatgctgtcgaaacctctaggggctgagttcgagattcgtgatcagaagcag
atggcaaaactgaagaaggaagaactcacggaggcatacatcaggaacgaagagatcgta
aaggcatgtttcgctcgacgaccgaactacaacgaccttatacctgtgcttctcgagatt
ggtgtttgcgacgaactactcgtgcgctgtgggctgtcactacacatccctttaagacct
atgttaggaagtatcactcgcgatatgggcgagatgctcacaaaactacaaggacgcgac
ttcgcctgcgagtacaagtacgatggacaaagagcgcaggtgcattgtgatgctaagggc
aaagtcacaatcttctcacgacatctggaagtgatgactgacaagtatccggatttagta
gcgctggtgcctaagatacgaggagagggcgtctcgagcttcattcttgaaggcgaagtt
gtagctgtcgatcgggagagtggagacctcaagacattccagacacttgcgaatcgcgca
agaaaagacgtcgtcgtcggtgccgtgacgatcgacgtctgtctgtttgcattcgacctg
atgtatctgaatggcgaagagctactgaaccggccttttagagaacggaggtctctactc
agaagtctgtttgtggagataccacatcattttacgtgggtcaagagcctagatgctacg
tccgccgacgtagaagcagtccaagccttcttccaaagtgccttggaaatcaagtgcgaa
ggcatcatggtgaagattcttgacaacctccctaaccccgacctactcgccgaaatcgac
gaagctattgagaagacgccctcgcttccaccaacacccaagaaaaagaagcccgcaaag
tccaaagctaagtcgaattctaacgaaaccgaaaaagacgaaccaaagacatctggccgc
cgtaaagcactcttatcgacttacgaaccggataagcgtctagacagctggctcaaagtg
aagaaggactatagtaccacctccgagactctcgacctgattcccattgccgcttttcat
ggttctggtcggaaggcagcatggtggtcacctatcctccttgccatccgcaacgcagaa
actggacaactggaagcagtcacaaaatgcatgtccggctttactgacaccttttacaaa
gccaaccgcgcaaagtacgacccagacgacccagattgcacaaacgtgctctctggcaaa
ccccattatgtagagtacaatggtggagctggaatgccagttgtttggttcgaaccgcaa
gaggtctgggaggtagctttcgccgatttgactttgagtccgacgtatacggctgcgatt
ggcttggtcagtgaggagagagggttgagtacgaggtttccgagattcttgagggtcaga
gaggataaggggatcgatgaggctactgaggcagaggaattagctagtctgtatcggaaa
caggaggctaaagcgcctaagaagaacgatgctatcacagaagtcatgtacgaagatgat
gagtag

DBGET integrated database retrieval system