KEGG   Alternaria alternata: CC77DRAFT_1046896Help
Entry
CC77DRAFT_1046896 CDS       T05291                                 

Definition
(RefSeq) hypothetical protein
  KO
K16743  abnormal spindle-like microcephaly-associated protein
Organism
aalt  Alternaria alternata
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aalt03036]
    CC77DRAFT_1046896
Chromosome and associated proteins [BR:aalt03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    CC77DRAFT_1046896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyrid_ox_like GST_N_2 GST_N_3 GST_N CH Putative_PNPOx IQ GST_C_2
Motif
Other DBs
NCBI-GeneID: 29113058
NCBI-ProteinID: XP_018389638
JGI: 1046896
UniProt: A0A177DX34
LinkDB All DBs
Position
Unknown
AA seq 1642 aa AA seqDB search
MSSASRLLVRSARIVLPRTQFTTRISTPAKITTPRYFSTTHIFQMPDQLKASEVNSKTDP
SVAKQYDDETPKDQQIKQFFEMVDGKKICMLNTYRNGVGPVGRSMALARRDGPDFLFLSN
AHSQKFNDLDQNKEVQISFQDLKTQEWASITGTATTTDNSDPRIKEVWSRGAAAWFGDLG
DGKHTGGPEDPRMTLIEIKSKYVSYYVTEVGLLGYAKEIIAANVTGGVANTGKLRELKEA
DLEKARSITVHRPNQVTIMGKDHPDADLHPEATGLASATVKAHAAECPLKLYSGWFCPFV
QRVWIALEEKGIQYQYIEVNPYHKPKSLLDLNPRGLVPTLQYQDKPLYESTVLCEFLEEA
YPQHTPHLMPTDAYERARTRIWTDYVGSRIIPAYHRFLQHQGDGLEEKQKDFLNHLKEFT
REMDAEGPFFSGKDFQLIDIVIAPWANRLWVFDHFKGGSGIPDEGKGGEDEEVWKRFRKW
LSAVENRRSVKETLSERQHYLPIYQRYAEDRAQSEAAKAIRAGRGIPKVVRPFLRCCCPG
DGVAISTSPPANMYGYTAGTPCPAPYSSTSSYYSGYGSHYAPAYYDENSTTANLEYTTEL
KPARHAKPRRPMRNMHKPAFNPSLDIFEDVAQEEEQQQAEFGVKRRSRASVVPAAARTKK
STILAHPAQRIPKPVAPVQEPHHEKPHRRRVSQVPTDKHASDTNATVQLQEDVLERKELK
KQAPKKDLRRRTIYIPSDDTSVFTIHPGQPTHAPRNVRETSPDIGLDLVTLSEEEGNNLM
PALKRDKKAPRKSLAAPPKRGPLSTTSRSSQSSSFSSDIVGSGGGKENMPPGIEAIEKKK
IGTHIEINFTKADAKKPVAKAPKVHFSAPKEPERILHTKKRPEGSQKRPRSHVAQDDVPA
KALKARADGTASAASSRASLRTTIKTERAKLAKAKRAPLSSSPFHTDKSPPTALRRQKTG
SVASSITMLHEVGQRPQSQEKYPVLQEDLAQPELYEDNWLTYQEVAITQLLNSVFDSASR
DPTDEQSPEDMRKKMLAIYHDPAIPSLHKRLQASLQFGALSIPKDLLAQTLRLKDDVGLR
KKFLSLWTKSYDLNALRAAAETIVGRQITTPCRLSTGSTCSDDGSRQYRAERRAIESFLS
AFLIKNEDAVRVKSGGGSIASLTRGDDDFGSQGWSWRRTALRSLMLILILDQAKTTDALS
GCLFQTTSPYKTSVEVLHQLSKMLLPSHGDITRPLNHLNYKVEHVQYPLQEYTYQIDNIA
IDLRDGIVLARLVELLLYPSTTHTTHQEDTVTLSLPSGELLNSSLDSSQKGIWVLSQHLK
YPAIGRPQKVYNVQIALAALSHVTGMPSAAVSGIKAEDIVDGHREKTLSLLWSLVGKCGL
GSLVDWPQLVKETERFRNQWYRARDSYEGRVLDSDNEEDGATELDGMAYHKRLLLSWSRS
VARLHGLRVANLTTSFADPKVLEAIVDTYLPSNLTISTEGNERLGLATKLKAVGCSTSFI
ALFTPQHSTARSIPSRDFTLLTLSFLASRLLPLARTHRAASTIQSAFRRFLVRRQVSTRI
QAMKIAHNCAVVAQARQKMVDAAIVIQRRWKAIQDARNKQLESDVLAFQALARGWAIRRW
VRRITAGRVGGKEKVRRVRGGW
NT seq 4929 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgcttctcgactacttgtacgctctgcaagaattgtcctgcctagaacccaa
tttacgactcgcatttcaacacctgccaaaatcactacccctcgatatttctcgacaaca
cacatcttccaaatgccggaccaactcaaggctagcgaggtcaactccaagaccgatccc
tcggtcgcgaagcagtatgacgacgagacgcccaaggaccagcagatcaaacaattcttt
gaaatggtagatggcaagaagatttgcatgctcaacacataccgcaatggtgtcggccct
gttggtcgctccatggctctcgcccgccgcgacggtcccgacttcctgttcctctccaac
gcacactcgcaaaagttcaacgacctggaccaaaataaggaggtccagatctccttccaa
gaccttaagactcaggaatgggcttctatcaccggcactgccacaacaacagacaacagt
gatcctcgcatcaaggaggtatggagccgcggagctgccgcatggtttggtgacctcggt
gacggaaagcacactggcgggcctgaggatcctcgcatgacgttgattgagatcaagagc
aagtacgtatcgtactatgtgacggaagtcggccttttgggttatgcaaaggagattatt
gctgcgaacgttacaggtggagtcgcaaatacaggcaagcttagggagctcaaggaggcg
gatttggaaaaggcacggtccataacagttcacagaccaaatcaagtcactatcatgggc
aaggatcatcctgacgcagaccttcaccccgaagcaacgggacttgcatcagccacagtc
aaagctcacgctgcagaatgtccgttgaaattatattcagggtggttttgccctttcgtg
cagcgcgtctggattgcactagaggagaagggcatacagtaccagtacattgaagtcaat
ccataccataagccaaagtcgctactggatctcaacccgcgcggcttagttcccacgcta
cagtaccaagacaagccactctatgagagtacggttttgtgtgaattcctcgaggaagct
taccctcaacacacaccgcacctcatgcctacagatgcgtatgagagggctagaacgagg
atctggacggactatgtaggtagtcgcatcatacctgcctaccaccgcttcctacaacat
caaggcgatggcttggaagagaagcaaaaggatttccttaatcacctgaaggagttcacg
cgcgagatggatgccgagggcccattcttctcgggcaaggactttcagctcatcgatata
gtcattgcaccttgggccaatcgactatgggtatttgatcacttcaagggtggctcaggc
attcccgatgagggcaaaggtggagaggacgaggaggtatggaagaggttcaggaagtgg
ctgtctgctgttgagaacaggaggagtgtcaaggagacgctgagcgagaggcagcattac
ttgccgatctaccagcgatatgcggaggaccgcgcacagtctgaggcggcaaaggctatc
agagctggccggggaattccgaaagtcgttcggccgtttcttaggtgttgttgcccgggt
gatggtgttgcaatctcgacctcaccacccgccaacatgtacggatacactgcgggcaca
ccctgcccggcgccctattcctccaccagcagctactacagcggctatggaagccactac
gcgcccgcctactacgacgagaacagcacgacggcaaacctcgaatacacgacggagctg
aagcccgctcgccacgcaaagccacgacgaccgatgcgcaacatgcacaagcccgccttc
aacccgtcacttgacatcttcgaggatgtcgctcaggaggaggaacagcaacaagcagag
tttggcgtcaagaggaggagccgcgcaagcgttgttcccgcggctgccaggaccaagaag
agcaccatacttgcgcacccagcacagaggatacccaagcctgtcgcgcctgtccaggag
ccacaccacgagaagccgcaccgaagacgcgtttcgcaggtgcccaccgataaacatgcc
tcagacaccaatgcgacggtgcagttgcaggaagatgtcttggagaggaaagaactcaag
aagcaggcccctaagaaggacttgcgacggaggaccatttacattccgtctgatgacacg
tcagtcttcaccatccaccctggacagccgacacatgcgccgcgcaacgttcgagagact
tcgccagacatcggcctagatctggtcacattatccgaggaagaaggaaacaatctgatg
ccagcgttgaagagggacaaaaaggcaccgcgcaagtctctcgctgcaccaccgaagcga
ggtcccttgagcacaacatcgcgatcatcgcagagctcatccttttcgagcgacatagtg
ggctcagggggcgggaaagagaacatgccaccaggaatcgaggctatcgagaagaagaag
atcggaacgcatattgagataaacttcaccaaggcagacgcgaagaaacctgtcgccaaa
gcccccaaggtccacttcagtgctcccaaagagcccgaacgcatacttcatactaagaaa
cggccagagggctcgcagaagcgaccacgatcacacgtggctcaagacgacgtaccagca
aaagcgctcaaggccagagcagacggcactgcttccgccgcaagtagcagggcatctctg
aggacgaccatcaagactgaacgagcgaaactggccaaggcgaagcgcgcgccactttcc
tcctcgccgttccacaccgacaaatctccacctacagcactgcgccgccagaagactggg
agcgtagcaagcagcatcaccatgctacacgaagtaggccagcgaccacaatcacaagag
aagtatccagtactacaggaggatctggcacagccggagttgtacgaagacaactggctt
acctaccaggaagtcgccattacacaacttctgaactcagtatttgattccgcgagcaga
gacccgaccgacgaacagagccctgaggacatgcgcaagaagatgcttgccatataccac
gatcccgctataccgtcgcttcacaagcgactacaggcctcactacaatttggtgcgctg
agcataccgaaggatctcctggcccagacgctcaggctcaaggacgatgttggcttgcgc
aagaagttcctcagcctatggaccaagtcatacgatctgaatgcattacgtgctgcagct
gagactattgtcggccgccaaattacaacgccctgtcgactatccacaggttcaacgtgc
tcagatgatggctcccgccagtatcgcgcagagcgccgggctatcgagagctttctgtct
gcattcctgatcaaaaatgaggatgctgttcgcgtcaaatccggaggtggcagcattgct
agccttacacgcggcgatgatgacttcggttctcaaggctggtcatggcgccgtactgct
ttacgaagtctgatgctgattctgatcctcgaccaagccaagacgacggatgctctatca
ggctgcctgttccagacgacgtcaccctacaaaacatctgtcgaggtcctacatcagtta
tcaaagatgctgctcccttcacacggcgacatcactcgaccgctaaaccacctcaattac
aaggtcgaacatgtccagtatccactacaagagtacacctaccaaatcgacaatatcgcc
attgacctccgtgatggaatcgtacttgctcgtcttgtagagttactgctttacccgtca
accacccacacaacgcatcaagaggataccgtcactctcagtctacccagcggtgagctt
cttaatagctccctcgattcttcgcagaaaggaatttgggtcctctcccagcacctcaag
tacccagccattggccgtccccagaaggtctacaatgtccagattgccctagctgcattg
agtcatgtcacaggcatgcccagcgcagcagtcagtggcatcaaagccgaagatattgtc
gacggacaccgcgagaagacactctcgcttctttggtcacttgtcggcaagtgtggtctt
ggaagccttgttgactggccgcaacttgtcaaagagacagagcgtttccgaaaccagtgg
tacagggcccgggatagctatgagggacgagtccttgattccgacaatgaagaagacggg
gccactgagctggatggcatggcatatcataagcgtctcttgctttcatggtcacgctcc
gttgctcggcttcatggcctacgcgttgcaaacctgaccacaagttttgcagacccaaag
gttctagaagccatcgttgatacctacttgccgtcgaatctgaccatctccaccgaaggg
aatgagcgactcggattagcaacaaaactcaaggctgtcggctgctcaacttcattcatt
gcgcttttcacgccacaacacagcacagctcgttcaatcccaagcagagactttaccctc
cttactctatctttcctggcaagtcgactgttgccgcttgcacgcacacaccgcgcagct
tctactattcaatccgctttccgccgtttcctagtccgccgtcaggtcagcactcgcata
caagcaatgaagatagcgcacaactgcgcagtagtggcgcaagctcgacagaagatggtc
gatgctgccattgtgattcagagacgttggaaggcgatccaagatgcccgcaacaagcaa
cttgaaagtgacgttttggctttccaggccttggccaggggttgggcaatcaggcgatgg
gtccgacgtatcaccgctggtcgagtcggtggaaaggagaaagtcaggagggtcaggggt
ggatggtag

DBGET integrated database retrieval system