KEGG   Alternaria alternata: CC77DRAFT_1061595Help
Entry
CC77DRAFT_1061595 CDS       T05291                                 

Definition
(RefSeq) glucoamylase I precursor
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
aalt  Alternaria alternata
Pathway
aalt00500  Starch and sucrose metabolism
aalt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC77DRAFT_1061595
Enzymes [BR:aalt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CC77DRAFT_1061595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 29114045
NCBI-ProteinID: XP_018385544
JGI: 1061595
UniProt: A0A177DK04
LinkDB All DBs
Position
Unknown
AA seq 524 aa AA seqDB search
MLPHVLLLAGFLHRSHAFSIPHVPRLGDFVGASHTQALQQPLQDSLDAWIEKEGRIALDK
LLANIAPGGSNVQGKGVADGTVIASPSQESPDYWFQWVRDAAITMNTLVDVYADGPSSSR
GSALSSILGAYTSLSSDIQHTSNPSGTFDDLSGLGEPKFHVDGTPFTGSWGRPQRDGPAL
RALTLMHYLREYNASHPSLWSSESSEDFFGPYYTAEMPPRSVIKADLEYVSHFWNQSSFD
LWEEVEGLHFFNLMVSARSLKEGSDLARTFGDMGAAQWYKEQADHIESFLGKFWDAQKNH
LVETLSSKRSGLDCALLLGSLHALPADDFEGDSAYPPWSDEILVSLLALARDQRDRFPIN
SNPSDEDQDDVEENSFEGTGIGRYPEDVYDGYGTSNRGGNPWFLCTSSAAEVLYRTASYL
SVAGNLTISGTGLPFFEALLATSSLDVDVGTFGPSDALFHSVIERLHTTGDQFLEVIKTH
VDAEGSMSEQFDRVTGYMRGAEDLTWSYGAFLQAARARKVFMGL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctacctcacgtacttctcctcgcaggcttcctccaccgtagccatgccttctcgata
ccacacgttcctcgcctcggcgattttgttggcgccagtcacacccaggcactgcagcag
ccgttacaagattcactcgatgcgtggatcgagaaggaaggacgtatagcactagacaaa
ctcctggcaaacatcgcacctggcggtagtaatgtccaagggaagggtgtagcggatggc
acggtcattgcgagtccgagtcaagagagtccagattactggttccaatgggttcgcgat
gctgccataactatgaacaccctcgtagacgtttatgcagacggcccatcctcttctcgc
ggttccgcgttgtcttctatcctcggcgcatatacttctctctcgagcgacattcagcac
acctcgaacccttcaggcacatttgacgatctctctggattgggtgaacctaagttccac
gtcgatggcacaccatttactggctcctggggacggcctcagcgtgacggcccagcgcta
cgggccttgacgcttatgcactatctgcgtgaatacaatgcctcacacccctcactctgg
agttcagagtcatctgaggatttcttcggaccatactacactgcagagatgccgccgcgt
agcgtcatcaaagccgacttggaatacgtcagtcacttctggaaccagtcaagtttcgat
ctttgggaggaagtcgagggcctgcacttctttaacctaatggtcagcgcaagaagtttg
aaggaaggtagcgatcttgcaagaacatttggagatatgggtgcagcgcaatggtacaaa
gagcaggctgatcacatcgagagtttccttggcaagttctgggatgctcagaaaaatcac
cttgtggagacgttgtcgagcaaaaggagtggactggattgcgcattgctccttggctct
cttcatgctctgcctgcagacgatttcgaaggcgactctgcatacccaccttggtctgac
gagattctcgtttcgcttcttgcccttgcccgtgaccaacgcgatcggttccccatcaac
agcaatccatcggacgaggaccaggatgacgtggaagaaaactcattcgaaggaaccggt
attgggcgttatccggaagatgtatatgacggatatggcacctctaaccgcggtggtaac
ccttggtttctgtgcacatcgtcggctgccgaggttctttaccgtaccgcatcatacctc
tcggttgctggcaatttgaccatctctggcaccggtctgcctttctttgaggccctcctt
gcaacatcatctcttgacgttgatgttggcacattcggcccgtctgatgcactctttcat
tccgttattgagcgattgcacaccacgggcgatcagtttctcgaggtcatcaagacgcac
gttgatgctgagggtagcatgagtgagcagttcgatcgtgtgacaggttatatgaggggc
gctgaggacctgacatggagctacggagcattcctgcaggccgccagagcgaggaaagtg
ttcatgggcctttga

DBGET integrated database retrieval system