KEGG   Alternaria alternata: CC77DRAFT_1068465Help
Entry
CC77DRAFT_1068465 CDS       T05291                                 

Definition
(RefSeq) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
aalt  Alternaria alternata
Pathway
aalt00052  Galactose metabolism
aalt00511  Other glycan degradation
aalt00600  Sphingolipid metabolism
aalt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CC77DRAFT_1068465
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CC77DRAFT_1068465
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CC77DRAFT_1068465
Enzymes [BR:aalt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CC77DRAFT_1068465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 Invasin_D3 BetaGal_dom4_5 Big_1
Motif
Other DBs
NCBI-GeneID: 29114673
NCBI-ProteinID: XP_018391210
JGI: 1068465
UniProt: A0A177E479
LinkDB All DBs
Position
Unknown
AA seq 899 aa AA seqDB search
MAARFICLGFLSLYNDLVGAYAVQTRNYDTSFTGRERVSINTDWRFWRSEKNPDGITYDN
RTDTPQGNVTYLRPWILPGANEFIQDVSKHYEAPTASPIVNIPYIQTSFDDSSWEDVTLP
HDWAIKGPYYIGDPTPITGGMARLPSQGVGYYRKKLSILNEDAGKVIYLDVHGAMSYAMV
WLNGNLVGGWPYGYNSFRLDLTPHLQPGNENQLVVRLDNPIDSSRWYPGAGLYRNVWLTK
VQPIHVANWGVHVSTRDVSAEAATVDISVHVEAKDNASQEVEVATDIYIYDAEVKKMREK
VVEFPRTSLMLSGSKQSANATVAIEDPHLWGPPPNQKPNMYVAVTSLLSHNSSIPIDTYE
THFGIRSFTYSGEEGLSVNGERLRIQGVDQHCHDLGALGSAWNDRAAKRQLEALRELGVN
AIRMAHNPPAPELLDMTDRMGFVVMDEIFDSWEQKKTDNDFHLIFPEWHEADLRSFIRRD
RNHPSIYSWSVGNEVGEQTCCGDRGYEIGRLLNDIVKSEDPSRPVTASMNVAKPNMTFPQ
AFDILSLNYQGEGIRDTPQYSFTNGTRTPPQYKPFHDAFPDKLIAESESAAALSSRGTYL
FPVTDLNSAPVNDTNGGGNSSLYYVSAYELHTANFGSSADKVFAAQDANPFVAGEFVWSG
WDYLGEPEPYYDARSSYFGVIDLAGFPKDRYYLYQARWRPDVKIAHIVPQHWNWAERVGM
VTPVHVFTNAEEAELWVNGVSLGRKSLSASEYRARWDEVVYQPGEVKVVTYKGGEEWATE
SVSTTGPPAALRLTVDRDEISADGLDLSFVTLEVVDGEGNVVRNAHHTIDFAIEGPGEIA
ATDNGFEADFVPFQSLQRDSFNGLALAIVKAKKGKPGSLTITAMAEGLEVGTVTITTKD
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaggttcatttgcttagggttcttatccctatataacgatctagtgggagca
tatgctgtacaaacacgaaattacgatacatcatttaccggtcgtgaacgcgtgagtatc
aatacagactggcggttctggcgatccgagaagaacccggatgggatcacgtacgacaac
cgcaccgatacgcctcaagggaatgtcacatacttgagaccatggattctcccaggcgcc
aacgaattcatacaagatgtgtcgaagcactatgaagccccgacggccagccctatcgtc
aacattccgtacatacaaacctccttcgacgacagttcttgggaggatgttacgttgccg
catgattgggcaatcaaaggaccctactacatcggagatccaactcctatcacaggtggc
atggcaaggctaccgtcgcaaggagtagggtattaccgaaagaagctatcaattctcaat
gaagatgcgggaaaggtgatctaccttgatgtccatggtgcaatgtcttacgctatggtt
tggctcaatggtaatttggtaggcggttggccatatgggtacaactcatttcgtcttgat
ctcacgcctcacttgcagccaggcaacgagaaccagttggtggtccggctcgacaatccc
atagactcttcgagatggtatccaggtgctggtctttaccgaaatgtctggttgactaag
gtccagccgattcacgttgccaattggggggtccatgtttcgacacgagatgtaagtgca
gaagctgcgactgtcgacatctcagtccatgtggaagccaaagacaatgcgagtcaagag
gttgaagttgctaccgacatatacatctacgatgcggaggtgaagaagatgagagaaaag
gtggtagaatttcctaggacaagtctaatgctgtccggaagcaaacaatctgcgaacgct
acagttgcaattgaagaccctcatttgtggggacctccgccaaaccaaaagccgaatatg
tacgtcgctgttaccagcctgttgagccacaacagtagtattccaatcgacacgtacgag
acacacttcggcatccggtcgtttacctacagtggcgaagaagggctttccgttaacggg
gaacgcctacgaatccaaggcgtagaccaacactgccatgaccttggagctctcgggagc
gcgtggaacgatcgtgcagctaaacgccaattggaggctctgcgagaactcggagtgaac
gctatccgcatggcgcataatccaccggcaccagagcttctcgacatgaccgaccgcatg
ggctttgtagtcatggacgaaatcttcgacagctgggaacaaaagaagacagacaatgat
ttccaccttatttttcccgagtggcacgaagctgatcttcggtcctttattcgaagggat
cgcaaccacccttccatttattcttggagcgtaggcaacgaagtcggcgagcaaacatgc
tgcggagaccgaggctacgagataggtcgcctactgaacgacattgtcaaatctgaagat
cctagccgacccgtcacggcgtccatgaatgtagcgaaaccaaacatgaccttccctcag
gctttcgacatcctgagcttgaactaccagggagaaggtatccgcgatacacctcagtac
tctttcacaaacggcacgcggaccccaccgcagtacaaacccttccacgatgccttcccg
gacaaactgatagcagaaagcgaatctgcggctgcactaagctcacgaggtacctatctc
ttccccgtcacagacctcaatagcgcccccgtgaacgacacaaatggcggtggaaactcg
tctctctactatgtctccgcctacgagctccataccgcaaactttggttcctcggccgac
aaagtatttgccgcgcaagacgcgaatccctttgtcgccggtgaattcgtatggtcaggc
tgggactacctaggcgagccggagccatactacgacgctcgcagttcctattttggtgtt
attgaccttgctggatttccaaaggatcggtattatctgtatcaggcaaggtggcgacca
gatgtcaaaatcgcacatatagtaccgcagcattggaattgggctgagagagtgggcatg
gtgacgcctgtgcatgtgtttacaaatgctgaagaggctgagctatgggtgaatggtgtg
tctctagggaggaaaagcctcagtgcgtccgagtatagggctagatgggatgaggttgtg
tatcagcctggtgaggtcaaggtggtaacgtacaagggtggagaggaatgggcgacggaa
agtgtgagcacaactgggccaccagccgcattaaggcttacggttgatcgagatgagatt
tcggctgacgggctggatctttctttcgttacgttggaagtggtggatggtgaagggaat
gttgtgcgcaatgctcaccacacaattgacttcgcaatcgaagggccgggagagattgct
gctacggacaatgggttcgaagcagattttgttccattccagtctctgcagagagattca
ttcaacggactagcattggctatcgtgaaggcgaagaagggaaaaccaggctccctgaca
atcacggctatggcagagggtctagaggtgggaactgtcaccatcaccacaaaagactag

DBGET integrated database retrieval system