KEGG   Alternaria alternata: CC77DRAFT_1095299Help
Entry
CC77DRAFT_1095299 CDS       T05291                                 

Definition
(RefSeq) alkaline phosphatase-like protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
aalt  Alternaria alternata
Pathway
aalt00730  Thiamine metabolism
aalt00790  Folate biosynthesis
aalt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CC77DRAFT_1095299
   00790 Folate biosynthesis
    CC77DRAFT_1095299
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aalt04147]
    CC77DRAFT_1095299
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aalt00537]
    CC77DRAFT_1095299
Enzymes [BR:aalt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CC77DRAFT_1095299
Exosome [BR:aalt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CC77DRAFT_1095299
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aalt00537]
 Enzymes
  CC77DRAFT_1095299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 29115383
NCBI-ProteinID: XP_018385874
JGI: 1095299
UniProt: A0A177DKW4
LinkDB All DBs
Position
Unknown
AA seq 599 aa AA seqDB search
MSGTRPLLSNRASSDISGDRDIAEEDALLTGQRTARMEKEGPRSWKFWREIGLFVWAVIA
TAAVIVLAVIFQRAGSDSKTSHASGKKNLIFMVSDGMGPTSLSLTRSFMQYKNGAPFNEQ
LVIDQHLIGQSRTRSASSLITDSAAGATAFSCAQKSYNGAISVTPDHEPCGTVLEAAKKA
GYMTGLVVTTRITDATPACFAAHVNMRSEEDRIAEQMVGDYPLGRVVDLMFGGGRCHFLP
NSTVDSSCRADDRDIVDLAKNNGFNYISDRAGFDSLKGGASLDLPMLGLFAETDIPYEID
RRNENDIYPSLHEMAEAAMKALSDATRDSDKGFFLMIEGSRIDHAGHHNDPAAQVHEVLA
YDRAFTSVLDFIKNEETQTVMVSTSDHETGGLAAARQLHASYPEYLWYPSPLANASHSAE
RLALDYTKHLLTDPSADETTDFVRESITSGLGIYDCTDKEVSDLVAEPATALYQYADMVS
RRSQTGWSTHGHSGADVNIYSSDPKAAMALVGNHENTEVGDFLRDYLGVDVESVTKELRE
KGTGLTVLDVNGTEVSWMGKVPEDGQRLDGQTHLASYGGDFKKRGDSGVVHGESCGCGH
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcacccggcctctcctctcgaaccgcgcgtcttcggacatcagcggtgatcgc
gatatagcagaggaagatgccctgctcacaggccagcgaacagcgcgcatggagaaagaa
ggaccgcgatcttggaagttctggagggagataggtctgtttgtctgggctgtcatcgca
acggcagccgttatcgtactcgccgtcatcttccaacgggcaggttccgactccaagact
tcacatgcgagcggaaagaagaacctcatcttcatggtttcggatggcatgggtcctacc
tcgctatcacttacgcgatctttcatgcaatacaagaacggcgcgcccttcaacgagcag
ctcgttatcgatcagcacctcatcggacagtcgcggacccgttctgcctcgtctctcatt
accgattcagcggcgggtgcgacggcattctcatgcgcacagaagagctataatggtgcc
atctccgtcacacctgaccacgagccatgcggaacggtgctggaagcggccaagaaggct
ggatacatgacgggtcttgtagttactacgaggatcacagatgcgacacccgcctgcttt
gcggctcacgtcaacatgcgatcagaggaggaccgtattgcagaacagatggtcggagac
tacccacttggccgcgtcgtcgatctgatgtttggaggcggacgatgccacttcctgccc
aactcgacagtcgactccagctgtcgcgcggatgacagggacattgtggacttggccaag
aacaatggattcaactacatctctgaccgcgcgggctttgacagcctgaagggaggagct
agtctcgacctgccaatgttgggactcttcgccgaaactgacatcccgtatgagatcgac
cgccgcaatgagaacgacatctacccaagcttgcacgagatggctgaggctgccatgaag
gcgctcagtgatgcaacgagggatagcgacaagggcttcttcctcatgattgaaggctcc
aggattgaccacgcaggccaccacaacgaccctgctgctcaggtacacgaggtcctcgcc
tacgacagggcctttacaagtgtgctggatttcatcaagaacgaggaaacgcagacggtc
atggtctcgacatcggatcacgagactggcggtctggctgctgctcgccagctccacgcg
tcttaccccgaatacctctggtacccctctcccctcgcaaatgcctctcattccgctgag
cgtctcgctctcgattatacaaagcatctgcttaccgacccatctgccgatgagacgact
gattttgtgcgtgaatcgatcacatctggtctcggcatctatgactgcaccgacaaggaa
gtctctgaccttgtcgccgaacctgccacagctttgtatcaatacgcagacatggtatcc
cgtcgttcacagactggctggtcaacccacggccacagcggtgcggacgtcaacatttac
tcctctgaccccaaggctgccatggcactggtaggcaaccacgagaacactgaggtcggg
gactttttgcgggactatttgggtgtggatgtcgaatcagtcaccaaggagctcagagaa
aagggtactggattgacggtactcgacgtgaacggcacagaggtcagctggatgggtaaa
gtgcctgaagatgggcaaagactggatggccagacccatttggccagctatggaggagat
ttcaagaagagaggtgacagtggtgtagtacatggggagtcgtgtggatgtggacattga

DBGET integrated database retrieval system