KEGG   Alternaria alternata: CC77DRAFT_356794Help
Entry
CC77DRAFT_356794  CDS       T05291                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aalt  Alternaria alternata
Pathway
aalt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CC77DRAFT_356794
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aalt02000]
    CC77DRAFT_356794
Enzymes [BR:aalt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CC77DRAFT_356794
Transporters [BR:aalt02000]
 Other Transporters
  Pores ion channels [TC:1]
   CC77DRAFT_356794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-GeneID: 29116947
NCBI-ProteinID: XP_018382246
JGI: 356794
UniProt: A0A177DAU1
LinkDB All DBs
Position
Unknown
AA seq 213 aa AA seqDB search
MSPTLHLYHTPGSCSLATHIALQASGLPFSTTNLNAARGFPASHLHLNPKGRVPILEVDG
ELITETPAILSVIAALVPEKGLLGKGLIAQARAQEWIIWLCGTLHGQAFGCVFRPGRFVG
DEAMFDAIRAKGREHVRECFKYIEKNLEGKTWVVGDSFTVVDAYLVVFYRWGNMLKMGMR
ETYPSYTRAVDGVVAQDDVKRTIESEAISVLNE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaactctccacctctaccacacaccagggtcttgttcgctagccactcatatc
gcactccaagcctccggtcttcccttctccaccacaaatctcaacgctgctcgtggtttc
cccgcttcccatcttcatctaaaccctaaaggccgcgttccaatcctcgaggtagatggc
gagctaatcaccgaaacacccgccatcctctccgtaatcgctgcgctagttccagagaaa
ggattactgggaaaaggtctgattgcgcaagcgagagcacaagagtggataatatggctt
tgcgggacgttgcatgggcaagcatttggatgcgtgtttaggccgggtcggtttgtcggg
gacgaagcaatgtttgatgctatacgagcaaaaggccgtgaacatgttcgagagtgtttc
aaatatatcgagaagaatctagaaggcaagacttgggtggttggtgatagttttactgtc
gtggacgcgtatctcgtcgtcttctaccgttggggcaatatgctgaagatgggtatgagg
gagacatatccgagctatacgagggcagtcgatggcgttgtcgcgcaggatgatgtgaaa
cgaacaattgagagcgaggccattagcgtactgaatgagtag

DBGET integrated database retrieval system