KEGG   Alternaria alternata: CC77DRAFT_504433Help
Entry
CC77DRAFT_504433  CDS       T05291                                 

Definition
(RefSeq) trypsin precursor
Organism
aalt  Alternaria alternata
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 29117543
NCBI-ProteinID: XP_018389611
JGI: 504433
UniProt: A0A177DYE0
LinkDB All DBs
Position
Unknown
AA seq 263 aa AA seqDB search
MRFQSIIAIALPALVLAAPTPQDPDYEFPEDAPADDIVGGTTASAGEFPFIVSLQRSGSH
FCGGSLLDSTTVITAAHCSVSSVIGSVSGLRVRAGSLNKSSGGTLVGVSSVTVHPSYRSS
GQDFDVAIWKLSTAVPTSSTIGYATLPASGFDPAAGSTATVAGWGALTEGGSSPSTLYKV
SVPIVSRTECRSSYGTSAITNNMFCAGYTTGGRDSCQGDSGGPIVNSAKTLIGLVSWGNG
CAQPNFPGVYARTAALLSFINSV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttccaatccatcatcgcaatcgcgcttcctgcgctcgtccttgcggctcccact
cctcaagaccccgactacgagttccctgaggatgctcccgccgacgacattgttggtgga
accactgcctctgcgggcgagttccccttcatcgtcagccttcaacgcagcggatcccac
ttctgcggtggctctctgttggactctactaccgtcatcactgctgctcactgctccgtc
agctccgtcattggctcagtcagcggtctccgtgtccgcgccggcagcctgaacaagagc
tccggtggaacactcgttggcgtatcttccgttactgtccacccaagctaccgcagctcg
ggccaggacttcgatgtcgccatttggaagctctccactgccgtccctactagcagcacc
atcggttacgcaactctccctgcttccggattcgaccccgctgctggatctactgcaact
gtcgccggatggggtgcccttactgagggcggcagcagtcccagcactctctacaaggtg
tccgtcccgatcgtttcccgcaccgagtgccgctcatcctacggaacctctgctatcacc
aacaacatgttctgcgctggatacaccactggtggtcgcgactcttgccagggtgactct
ggcggccccattgtcaactccgccaagactcttattggtctcgtttcttggggtaacggc
tgtgctcagcccaacttccctggtgtatacgctcgcaccgccgcccttctctccttcatc
aactctgtttaa

DBGET integrated database retrieval system