KEGG   Alternaria alternata: CC77DRAFT_504433Help
Entry
CC77DRAFT_504433  CDS       T05291                                 

Definition
(RefSeq) trypsin precursor
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
aalt  Alternaria alternata
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aalt01002]
    CC77DRAFT_504433
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aalt04147]
    CC77DRAFT_504433
Enzymes [BR:aalt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     CC77DRAFT_504433
Peptidases [BR:aalt01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   CC77DRAFT_504433
Exosome [BR:aalt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CC77DRAFT_504433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 29117543
NCBI-ProteinID: XP_018389611
JGI: 504433
UniProt: A0A177DYE0
LinkDB All DBs
Position
Unknown
AA seq 263 aa AA seqDB search
MRFQSIIAIALPALVLAAPTPQDPDYEFPEDAPADDIVGGTTASAGEFPFIVSLQRSGSH
FCGGSLLDSTTVITAAHCSVSSVIGSVSGLRVRAGSLNKSSGGTLVGVSSVTVHPSYRSS
GQDFDVAIWKLSTAVPTSSTIGYATLPASGFDPAAGSTATVAGWGALTEGGSSPSTLYKV
SVPIVSRTECRSSYGTSAITNNMFCAGYTTGGRDSCQGDSGGPIVNSAKTLIGLVSWGNG
CAQPNFPGVYARTAALLSFINSV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttccaatccatcatcgcaatcgcgcttcctgcgctcgtccttgcggctcccact
cctcaagaccccgactacgagttccctgaggatgctcccgccgacgacattgttggtgga
accactgcctctgcgggcgagttccccttcatcgtcagccttcaacgcagcggatcccac
ttctgcggtggctctctgttggactctactaccgtcatcactgctgctcactgctccgtc
agctccgtcattggctcagtcagcggtctccgtgtccgcgccggcagcctgaacaagagc
tccggtggaacactcgttggcgtatcttccgttactgtccacccaagctaccgcagctcg
ggccaggacttcgatgtcgccatttggaagctctccactgccgtccctactagcagcacc
atcggttacgcaactctccctgcttccggattcgaccccgctgctggatctactgcaact
gtcgccggatggggtgcccttactgagggcggcagcagtcccagcactctctacaaggtg
tccgtcccgatcgtttcccgcaccgagtgccgctcatcctacggaacctctgctatcacc
aacaacatgttctgcgctggatacaccactggtggtcgcgactcttgccagggtgactct
ggcggccccattgtcaactccgccaagactcttattggtctcgtttcttggggtaacggc
tgtgctcagcccaacttccctggtgtatacgctcgcaccgccgcccttctctccttcatc
aactctgtttaa

DBGET integrated database retrieval system