KEGG   Alternaria alternata: CC77DRAFT_637765Help
Entry
CC77DRAFT_637765  CDS       T05291                                 

Definition
(RefSeq) PLP-dependent transferase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aalt  Alternaria alternata
Pathway
aalt00250  Alanine, aspartate and glutamate metabolism
aalt00410  beta-Alanine metabolism
aalt00430  Taurine and hypotaurine metabolism
aalt00650  Butanoate metabolism
aalt01100  Metabolic pathways
aalt01110  Biosynthesis of secondary metabolites
Module
aalt_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CC77DRAFT_637765
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CC77DRAFT_637765
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CC77DRAFT_637765
   00430 Taurine and hypotaurine metabolism
    CC77DRAFT_637765
Enzymes [BR:aalt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CC77DRAFT_637765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 29118158
NCBI-ProteinID: XP_018389373
JGI: 637765
UniProt: A0A177DY91
LinkDB All DBs
Position
Unknown
AA seq 509 aa AA seqDB search
MSHTQQEKPLNRADEVKDLLDAVQELIIPFIRSADEDAATKHTGHGLKIEGGGPRTALVE
HHPPKKLESILKEELEIKDERAGKDGLVKLVGSVLKYSVNTWDQGFLDKLYASTNAVGVV
SELLLAVLNTNSHVYQVSPVLTLVEKRTTKYLASLFGLPSSTSGGISQPGGSASNSAAIV
IARNNLYPETKTDGNGSHKFTIFTSAHGHYSVEKAANLFGLGSKNVISVPVDDRGCIIPS
EFERCVKESKDRGETPFFLNATAGTTVLGSFDPFTALNKICKEQNLWFHIDGSWGGSVVF
NAQYRESRLKGAELADSITINPHKMLGVPMTCSFLLGRDMNTFYRALTLPAGYLFHNAPG
TDAADIYDLADLTPQCGRRADSLKMFLALQYYGAQHFSDLVARGYQNGEYLLSKLKESGN
FKTISPEPLPCQQVCFYYAKGGNLGDEADANSKATTEIANRLISRGFMIDFAPGEKGKFF
RVVVNGGLIKGTLDGLVKALEETATDLGY
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacacacagcaagaaaaaccactcaatcgcgctgatgaagtcaaagaccttctc
gacgccgtgcaagagctgataataccctttattcgctccgcagatgaagacgcagcgaca
aaacacacaggccatggactgaagatcgaaggtggtgggcctagaaccgcgttagtggag
catcacccacctaagaagctcgaatccatcctcaaggaagagctggaaatcaaggatgaa
agagctggtaaagatgggctggtgaagctcgtgggaagtgttttgaagtactccgtaaac
acatgggatcaaggattcctggataagctttacgcaagtacaaatgctgtgggagtagtc
agcgagctgttattggcggtattgaacaccaactcacacgtataccaagtctcacctgtt
ctaacacttgttgaaaaacgcactacaaagtatctagcctcactatttggccttccctcc
tctacttcaggaggcatctcccaaccaggcggcagtgcatcaaacagcgctgccatagtg
attgcccgcaacaacctttaccccgagaccaaaactgacggcaatggatcccacaaattc
accatcttcacatcagcccacggtcactactcggtcgagaaagcagccaacctcttcggt
ctcggttccaagaacgtgatttctgtccctgttgacgatcgaggctgtatcattccctcc
gagttcgaacgctgtgtgaaagaaagcaaagaccgaggcgaaacaccctttttcctaaac
gcaacagccggaaccaccgtccttggctccttcgaccccttcaccgctctcaacaagata
tgcaaagagcaaaacctctggttccatatagatggcagctggggaggaagcgtggttttc
aacgcccaataccgcgaatcacgcctcaagggcgctgaactcgccgacagtataaccatc
aacccgcacaaaatgctcggcgtgcccatgacatgttcattccttctcggtcgcgacatg
aacaccttctaccgcgcacttacgctacccgctggctatctcttccacaacgcacctggt
accgacgcagcggacatctacgatcttgctgatctaacacctcaatgcggtcgtcgcgcc
gactcgctcaagatgttcctggcccttcaatactacggtgcgcagcacttcagcgacttg
gtagcccgtgggtaccagaacggagagtatcttttgagcaaactgaaggagagcggcaac
ttcaagacgatcagtccggagccgctaccgtgtcagcaggtgtgcttttactatgccaaa
ggaggaaacctgggggatgaggcggacgccaatagtaaggcaacgactgagattgccaac
agacttatcagtagagggttcatgattgactttgcccccggggagaagggcaagttcttc
agagtcgtggttaatggggggttgatcaaggggacgctagatgggctcgtcaaggcactt
gaagagacggcgacagatttggggtattag

DBGET integrated database retrieval system