KEGG   Alternaria alternata: CC77DRAFT_931421Help
Entry
CC77DRAFT_931421  CDS       T05291                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aalt  Alternaria alternata
Pathway
aalt00010  Glycolysis / Gluconeogenesis
aalt00051  Fructose and mannose metabolism
aalt00052  Galactose metabolism
aalt00500  Starch and sucrose metabolism
aalt00520  Amino sugar and nucleotide sugar metabolism
aalt01100  Metabolic pathways
aalt01110  Biosynthesis of secondary metabolites
aalt01130  Biosynthesis of antibiotics
aalt01200  Carbon metabolism
Module
aalt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aalt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC77DRAFT_931421
   00051 Fructose and mannose metabolism
    CC77DRAFT_931421
   00052 Galactose metabolism
    CC77DRAFT_931421
   00500 Starch and sucrose metabolism
    CC77DRAFT_931421
   00520 Amino sugar and nucleotide sugar metabolism
    CC77DRAFT_931421
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CC77DRAFT_931421
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aalt04131]
    CC77DRAFT_931421
Enzymes [BR:aalt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CC77DRAFT_931421
Membrane trafficking [BR:aalt04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CC77DRAFT_931421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 29119807
NCBI-ProteinID: XP_018387886
JGI: 931421
UniProt: A0A177DRP6
LinkDB All DBs
Position
Unknown
AA seq 483 aa AA seqDB search
MADMPKDLKEQIDKLEDMFVVPTDKLKKISDHFVGELEKGLSEQGGSIPMIPTWCMAFPD
GNETGSYLALDMGGTNLRVCEVTLTEEKGEFEIIQSKYRMPEELKTGTADELWGYVADCL
QQFIEYHHENEQLDHLPLGFTFSYPVSQDAIDHGVLQRWTKGFDVAGMEGVDVVPGFKAA
LEERGVPIKLAALVNDTTGTMIASAYTNTSIKIGCIFGTGCNAAYMEECGAIPKLKHMNL
DPKLPMAINCEWGAFDNEHQVLPRTKYDVIVDKESPRPGQQSFEKMVAGLYLGEIFRLVL
QDLHKGNECHMFEGQNASKLDKPYSLDAGFLSSIEEDRFENLQDTHDLFQEKLGLDCTKP
ELELIRRLAELIGTRAARLTACGVSAICKHKKWDEVHVGADGSVFTKYPHFKVRQAQALK
EIMGWPNKYGKGKGDPVEVLPAEDGSGVGAALIAALTVKRVQQGQLAGIRDADTLLSMVP
KKK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatgcccaaggatctgaaggagcagatcgacaagctggaagacatgtttgtc
gttcccacagacaagctgaagaagatttcggatcacttcgtcggcgaactcgagaagggc
ttgtcggaacagggcggaagcattcccatgattcccacctggtgtatggccttccccgat
ggcaacgaaaccggcagctacctcgccctcgacatgggcggtaccaacctgcgtgtctgc
gaggttaccctgacagaagagaagggcgagttcgagatcatacaatcaaagtaccgcatg
cccgaagagttgaagaccggaaccgccgacgagctctggggctacgtcgccgactgtctt
cagcagttcatcgaataccaccacgaaaacgagcagctcgaccatctgcccctcggtttc
accttctcataccccgtctcgcaagacgccatcgaccacggagttctccagcggtggacc
aagggcttcgatgtagccggcatggagggtgtcgacgtcgtaccaggcttcaaggccgct
ctcgaagagcgtggtgtacccatcaagcttgccgctctggtcaacgacacgaccggtacc
atgatcgcttctgcctacaccaacacgagcatcaagattggctgcattttcggtaccggc
tgcaacgctgcctacatggaggagtgtggcgccatccccaagttgaagcacatgaacctt
gaccccaagctgcccatggccatcaactgcgagtggggagcctttgacaacgagcaccag
gtcctcccaaggacaaagtacgatgtcattgttgacaaggagtcaccacgacctggtcag
caatctttcgagaagatggtcgctggtttgtaccttggcgagatcttccgtttggttctc
caggatctacacaagggtaacgaatgccacatgttcgaaggccaaaacgctagcaagctc
gacaagccttactcgcttgacgcaggtttcctgtcttcaattgaggaggacagattcgag
aacttgcaagacacacacgatctcttccaggagaagctcggcctcgattgcaccaagccc
gaacttgagctcatccgccgcctcgccgaactcatcggtacgcgtgctgcccgtcttacc
gcatgcggtgtctccgccatctgcaagcacaagaagtgggatgaagttcacgtcggtgct
gatggctctgtcttcacaaagtacccacacttcaaggtccgccaagctcaggcgctcaag
gaaattatgggctggccgaacaagtatggcaagggcaagggcgaccctgtcgaggtcctc
cccgctgaggacggttctggtgtcggtgccgccctcatcgccgcgcttactgttaagcgc
gtgcagcagggtcagttggctggaatcagagacgccgacactcttttgtccatggtccca
aagaagaagtag

DBGET integrated database retrieval system