KEGG   Alternaria alternata: CC77DRAFT_932876Help
Entry
CC77DRAFT_932876  CDS       T05291                                 

Definition
(RefSeq) hypothetical protein
Organism
aalt  Alternaria alternata
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_N_4 DUF2944 GST_C GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 29119880
NCBI-ProteinID: XP_018387348
JGI: 932876
UniProt: A0A177DQZ4
LinkDB All DBs
Position
Unknown
AA seq 680 aa AA seqDB search
MQQASSPVLQQLRSLHPGAIQTLHQSPDGTLYPHNQVLPELQNLHTSDVYQHQYALSGPQ
HPPPPSHAHALPVHFEQHALPPSGPYPPFQPAGYQHGASPRFMNAPPPPLQDHAQQYHAS
PPQTIQRPIQQLPLPPPAPPILSAPQPLPRHVEQAPLPHKQESQEEDTPLSNHGQFQGLK
LIPNPPDLEQWRERLFHVDDMITLTEEQFQTYFPHIDNVYSHRSTQRHKRKRFVSHYWDC
RLKGRPPGTKKSTDPDKKKRKRIARERDLCDVKIKITEFFDRREYEEQLGRRPPGTENDP
PSPIASNMPINPGLGGSQNQNPQFFGQPPLLPQQPAGTWDVPPNMGSQPGMNIQEYPTSS
GSSSKKFYTFQRVNGNGGNGKGDGVAGPHKHTLEESDRVKKNSVIRWQAKIDKDDRRKMQ
GGDSSKKTYHKKATGNALTTVKNHSKEDDLKLYGSAFCPFVQRVWISLEHKQIPYQYIEV
DPYKKPQSLLDVNPRGLVPAIRHGPTWSTHESTVIMEYLEDLQTGSHLLPPDAQTRATSR
LWSDHVNRNIIPWFYKLLQSQDSNDQVSHAKELRDQIGKLVDAADPNGPFFLGPQISFVD
VQIAPWVLRLRRVLGPYRGWPEAEEGSRWKRWIDAIEADRSVKMTTSTDELYLDSYERYA
ENRPGTSQLADAVNSGRGLP
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggcctcctcgcctgtcctccagcagctccggtcactgcaccctggtgccatt
cagacgctccaccagtcgccagatggaacgctatacccccacaaccaggtcctaccggag
cttcagaacctccacacgagcgatgtataccaacaccaatatgccctgagcgggccacaa
cacccaccaccaccctcacatgcccacgcgctgccagtgcatttcgagcaacatgcgctt
ccgccttcaggaccgtacccgccttttcagccggcgggctatcaacacggcgcaagtcca
cgattcatgaacgcgccccctcccccactccaggaccacgcgcaacaatatcacgcgtct
cctcctcagacgatacaacgcccgattcagcagcttcccctgccaccgcctgcaccgccc
atactctcggcaccgcaaccactgccacggcatgtagaacaagcgccgttgccgcataag
caagagagtcaggaggaggacactccattgtccaaccatggccaatttcaaggcctgaag
ctcatccccaacccgccagacttggagcaatggagggagagattgtttcacgtggatgac
atgattactctgactgaggagcaatttcagacctacttcccgcatatcgacaacgtctac
tcgcatcgctcgacccagcgccacaaacggaagcgctttgtatcacactactgggactgt
cgactcaaggggcggccaccaggaaccaagaagtccacagatccagacaagaaaaagagg
aagagaattgcgagagagcgggatctatgcgatgtcaagatcaagatcaccgagttcttc
gatcgacgcgagtatgaggaacagcttggtcggcgaccgccaggcacggaaaacgatccg
cctagcccgatagcatccaacatgccgataaacccaggtcttggtggaagccagaatcag
aacccgcagttcttcggacagccaccgttgctaccacagcagccggctggaacctgggat
gtacctccaaacatgggttctcagccagggatgaacatccaggaatacccaacatcatct
ggctcttcgtccaagaagttctatacgtttcagagagtcaatgggaatggcggcaatggc
aaaggcgacggcgttgctgggccacataaacatacactcgaagagagtgatcgcgtaaag
aagaacagcgtcatcagatggcaggcaaagatcgacaaagatgacaggaggaaaatgcag
ggcggagattcttccaagaagacgtaccacaagaaagccactggaaatgctttgacgaca
gtcaagaaccattcgaaagaggacgaccttaagctgtacggtagcgcgttctgtcccttt
gtgcagcgcgtatggatatccctagaacacaagcaaataccctaccaatacatcgaagtg
gacccctacaagaagcctcaaagccttctcgacgtcaacccacgcggtctggtacccgct
atccgacacggcccaacatggtcaacccacgagtcaaccgtcattatggaatacctcgaa
gacctccaaaccggatcccacctcctgcctccagatgcacaaacgcgcgctacctcgcgc
ctctggtctgaccatgtcaaccgcaatatcatcccatggttctacaagctcctccaatcc
caagactccaacgaccaagtttctcacgcaaaggagctgcgggatcaaatcggcaaacta
gttgatgctgcggatcccaatggtcctttcttccttggtccccagatctctttcgtagat
gtacagatcgcgccgtgggtgctacggttgcgcagggtgttgggaccttataggggctgg
cctgaggctgaagagggaagcaggtggaagcgatggatcgatgcgattgaggcggatagg
agtgtcaagatgactactagtactgatgagctttatttggatagctatgaacggtatgcg
gagaataggccggggactagtcagcttgcggacgctgttaacagcgggaggggcttgcct
tga

DBGET integrated database retrieval system