KEGG   Alternaria alternata: CC77DRAFT_939218Help
Entry
CC77DRAFT_939218  CDS       T05291                                 

Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
aalt  Alternaria alternata
Pathway
aalt00220  Arginine biosynthesis
aalt00250  Alanine, aspartate and glutamate metabolism
aalt01100  Metabolic pathways
aalt01200  Carbon metabolism
aalt01210  2-Oxocarboxylic acid metabolism
aalt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CC77DRAFT_939218
   00220 Arginine biosynthesis
    CC77DRAFT_939218
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aalt01007]
    CC77DRAFT_939218
Enzymes [BR:aalt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CC77DRAFT_939218
Amino acid related enzymes [BR:aalt01007]
 Aminotransferase (transaminase)
  Class I
   CC77DRAFT_939218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 29120260
NCBI-ProteinID: XP_018384416
JGI: 939218
UniProt: A0A177DGV9
LinkDB All DBs
Position
Unknown
AA seq 486 aa AA seqDB search
MSKAPQKVLQIGNINPHVKAAKYAVRGELAVKSEEYRAQLAKGEGKDLPFDTVIAANIGN
PQQLDQKPITFFRQVASILENPGLLEHEDVLLKSLGYKSDVLERARKLLKEVKSVGAYSQ
SQGAPGIRQSVAEYIERRDGYPAKFEDIYLSNGASSGVNTLLHTICAKPETGIMVPIPQY
PLYTATLSVLDARCVPYYLNEDQAWGTSLDSIATAYEQAVKEGTDVKAICVINPGNPTGA
SLPAEDIKAVLKFAAEKGLVVIADEVYQTNVFIGEFISFKKALRDLQKESPGQYDHLELA
SLHSVSKGMVGECGHRGGYFELIGFDPEVAQEVYKFISIQLCPPVLGQCIVEMMVNPPKE
GEPSYELYKQEYDGIFNGLKKRAYALYEAFKQMEGVECNEPQGSMYLFPTIHLPEKAVQQ
AKKEGRAPDEFYCFRMLDATGVCVVAGTGFGQKEGTLHFRTTFLAPGTDWTGRIVKFHEE
FMKEFK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggcaccgcagaaggtgttgcagattggcaacatcaacccacacgtcaaggca
gccaagtatgccgtccgtggtgaactagccgtcaagtcggaggagtaccgcgcccagctg
gcaaaaggcgagggcaaggaccttcctttcgacacggtcatcgcggccaacattggaaac
ccacagcagctagaccaaaagcccatcacattcttcaggcaggtcgcgagtatactcgag
aaccctggcctgttggagcacgaggacgttctgctcaagagccttggatacaagtcggac
gtgcttgagcgcgcgaggaagctgctcaaggaggtcaagagcgttggcgcatacagtcag
agtcagggtgcaccaggcatcaggcagagcgttgcagagtacatcgagcgacgcgatggc
tacccggccaagttcgaggatatctacctcagcaacggcgcctcgtcaggcgtcaacact
ctcctccacaccatctgcgcgaagcccgagaccggtatcatggtcccaatcccacagtac
ccgctctacaccgcgaccctttccgtcctcgacgctcgctgcgtaccatactatctcaat
gaagaccaagcatggggcacatcacttgactcgattgcgactgcttacgagcaggctgtt
aaggagggcacagatgtcaaggccatctgcgttatcaacccaggtaaccccactggagca
tcactgcccgctgaagacatcaaggccgtgctcaagtttgccgccgagaagggtctcgtc
gtaatcgcagacgaggtctaccagaccaacgtcttcatcggcgagttcatctctttcaag
aaggctcttcgcgacttgcaaaaggaatctccaggccagtacgaccacctcgagctcgct
tctctgcactcggtgtccaagggcatggttggcgagtgcggtcaccgaggtggttacttt
gagcttatcggcttcgacccagaggttgcgcaggaagtctacaagttcatctctatccag
ctgtgcccacccgtgttgggtcaatgtatcgtggagatgatggtcaacccaccaaaggag
ggcgagccaagctatgagctgtacaagcaggaatacgatggcatcttcaacggactgaag
aagcgcgcctatgccttgtatgaggcattcaagcagatggagggtgtcgagtgcaatgag
ccacagggctccatgtaccttttccctaccatccacctcccagagaaggctgtacaacaa
gccaagaaggaaggtcgcgcgccggatgagttctactgcttccgcatgttggacgccact
ggtgtctgcgtcgttgccggtacaggattcggacagaaggaaggcacactgcatttcagg
acaactttcctcgctcctggaacggactggactggccgtatcgtcaagttccacgaggag
ttcatgaaggagttcaagtag

DBGET integrated database retrieval system