KEGG   Alternaria alternata: CC77DRAFT_966271Help
Entry
CC77DRAFT_966271  CDS       T05291                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
aalt  Alternaria alternata
Pathway
aalt00052  Galactose metabolism
aalt00500  Starch and sucrose metabolism
aalt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CC77DRAFT_966271
   00500 Starch and sucrose metabolism
    CC77DRAFT_966271
Enzymes [BR:aalt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CC77DRAFT_966271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 29121326
NCBI-ProteinID: XP_018384467
JGI: 966271
UniProt: A0A177DHT1
LinkDB All DBs
Position
Unknown
AA seq 910 aa AA seqDB search
MVNILMLGLLACSSFTHAIPIAQQSADVTSILNRRAAVDACPGYTASNVVESDSGLTADL
TLSGAACNAYSDDIKDLKLLVEYQTDDRLHVKIYDADEQVYQVQEEVFPRPKHEKASAGS
AALQFGIKTSPFSFAVKRRDNGEVLFDTGTVPLVFEKQYVRLRTKLPDNPNLYGLGEHSD
SFRFATDNYERVLLNAESPNIPRNANLYGTHPVYFDHRGDKGTHGVFMLNSSPMQVEIKK
VNGYQYLEYNTIGGVIDLYFMAGSKPAEVSKQYADIAGYSAMYPYWTFGFHQCKYGYWDV
NMVAEVVGNYSTAGIPLEVMWTDIDYMYLREDFTTDRERFPLSKMRELVQTLHSRDQRYI
LILDPGIHAVGGQYVTYQKGHDMEVFLKAADGTDLLGVQWPGEVAWPDWFAPNTEKWWAG
EIQANFNPENGIDLDGLWVDMNEASNFCQDVTTCNPRQQAIDQNIPPPPTNPPRPNTGRP
IPGFPASFQPGSTLKALRASKSVSPRQSSNGNMKGFPDREWFKPAYHINSHLGDVSRQTI
PMNTTNYDGTYQYDTHNMYGHMMAGTTREAMLARRPALRPFVLTRSTFAGSGSKVAHWFG
DNFSAWDDYRISIRQMLSFVSMHQMPMVGSDICGFNGQADQYMCARWAVMGAFQPFYRNH
AANDAAQQEFYQWPVVAEAAKKAIDTRYKLLDYIYTGLYYQGKEGTPMINPMFFLYPEDT
NTFGLDQQWFYGDALLITPVVTEYSDTVTYYLPEDTFYDYWTYAKVEGEGKNVTVSNLGY
SDIPVHIRGGSIVPQRVTSANTTKAVRQQDFLVIVAPDADGKATGRLYLDDGESIQQSGT
SEISFSFDGGKFSATGTFGYSGADGESITVGQVVVLGQSQAGATGNFDADKGAVTVDGPW
KMNKEFGFQL
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatattcttatgctcgggcttctcgcctgctcgagcttcacccacgcgattcct
atagcgcagcaatctgccgatgtcacgagcatcctcaaccgtcgtgcagcagtcgacgcc
tgccctggctacactgcttccaacgttgttgagagcgactcaggattgacggccgacctt
actctttctggcgcggcgtgcaacgcctacagtgatgatatcaaggacttgaagttactc
gtcgagtaccagaccgacgaccgtcttcacgtcaagatttatgacgccgacgaacaagtc
taccaggttcaggaggaagtgtttccccgccccaagcacgagaaggcgtccgctggaagt
gctgcacttcagtttggtatcaagacgagcccattctccttcgctgtaaaacgtagggac
aatggcgaggttctatttgataccggtactgttccccttgtctttgagaagcagtatgtt
cgcctgcgtactaagttgcccgacaaccccaacctctacggtcttggggagcacagcgac
tctttccgcttcgctacggacaactacgagcgtgtcttgcttaatgcggaatcacccaac
attcccaggaatgctaacctgtacggaacgcatcccgtctactttgaccaccgcggtgac
aaggggactcacggcgtcttcatgctcaactccagccctatgcaagttgaaataaaaaag
gtcaacggctaccagtaccttgagtacaacaccatcggtggagtcattgatttgtacttc
atggctggtagcaagcccgccgaggtctccaagcaatacgctgacatcgccggctactcc
gccatgtacccgtactggacctttggtttccaccagtgcaagtatggatactgggacgtc
aacatggtcgctgaggttgttggcaactattcgactgctggaattcccctcgaagtcatg
tggaccgacatcgactacatgtaccttcgcgaggatttcacgactgaccgcgagcgcttc
cctctctcgaagatgcgcgagcttgtacagacgcttcactctcgcgaccagcgctacatt
ctgattctcgaccctggtattcacgctgttggcggtcagtacgtcacttatcagaagggt
cacgacatggaagtcttcctcaaggccgcagacggtaccgatctacttggcgtacagtgg
cccggtgaagtcgcatggcccgattggttcgcgcccaacacagagaagtggtgggctggt
gagattcaggcaaacttcaacccggagaacggtatcgatctggatggtctctgggtcgac
atgaacgaagcctccaacttctgccaggatgttaccacctgcaacccccgtcagcaagcg
atcgatcagaatattccaccaccgcctacgaacccgccacgacccaacactggccgtcct
attcctggattcccggcttcgttccaaccaggaagcacgctcaaggctcttcgtgcctca
aagtctgtctccccccgccaatcttccaatggcaacatgaagggcttccccgaccgtgaa
tggttcaagcccgcgtaccatatcaacagccatctgggcgacgtttctcgtcagaccatt
cccatgaacactacaaactacgacggtacctaccagtacgacacgcacaacatgtacggc
cacatgatggcgggaactacccgcgaagcgatgctggcccgccgtcccgcgctccgtccc
ttcgtgctgacgcgctccaccttcgctggatctggtagcaaggttgcccattggtttggt
gacaacttctcagcctgggacgactaccggatttctatccgtcagatgctgtctttcgtc
tcgatgcatcagatgcccatggttggctctgatatctgcggtttcaacggccaagcagac
cagtacatgtgcgctcgctgggctgtcatgggagccttccagcccttctaccgtaaccac
gcagcaaatgacgccgcccaacaggagttctaccagtggcccgttgtcgctgaagctgct
aagaaggctattgatacccgttacaagctccttgactacatctacactggcctttactac
cagggcaaggagggtacacctatgatcaacccaatgttcttcctttacccagaggacacg
aacacgtttggtctcgaccagcagtggttctacggtgacgcgctgttgattacgcccgtt
gtaactgagtactccgacaccgtcacgtactatctgcccgaggacaccttctacgactac
tggacctacgcaaaggtcgagggtgagggtaagaacgtcactgtcagcaacttgggctac
agtgacattcctgtccacatccgcggtggctccatcgtcccgcaacgtgtcaccagcgcc
aacacgaccaaggctgtgcgtcaacaagacttcctcgtcattgttgcgcctgatgcggat
ggcaaggcgactggacgtctgtacctcgatgacggagagagcattcagcagtctggtacc
agcgaaatctccttctcgtttgatggtggcaagttcagcgcgacaggtacattcgggtac
tcgggtgccgatggagagagcatcaccgttggccaagtcgttgtgctgggccagagccag
gctggcgctaccggcaactttgacgctgataagggtgctgtcacggtcgatgggccgtgg
aagatgaataaggagtttggtttccagctatga

DBGET integrated database retrieval system