KEGG   Alternaria alternata: CC77DRAFT_973065Help
Entry
CC77DRAFT_973065  CDS       T05291                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aalt  Alternaria alternata
Pathway
aalt00250  Alanine, aspartate and glutamate metabolism
aalt00410  beta-Alanine metabolism
aalt00430  Taurine and hypotaurine metabolism
aalt00650  Butanoate metabolism
aalt01100  Metabolic pathways
aalt01110  Biosynthesis of secondary metabolites
Module
aalt_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CC77DRAFT_973065
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CC77DRAFT_973065
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CC77DRAFT_973065
   00430 Taurine and hypotaurine metabolism
    CC77DRAFT_973065
Enzymes [BR:aalt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CC77DRAFT_973065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 29121466
NCBI-ProteinID: XP_018380930
JGI: 973065
UniProt: A0A177D9A4
LinkDB All DBs
Position
Unknown
AA seq 549 aa AA seqDB search
MAGLARHVDTDELLETLKDHPIHKAGGHKSANRATSHITPYSSRYAAGTELSKFKIPHDG
APADVVHQLLKDELDLDGRPQLNLASFVGTYMEKEAEQLMIENLSKNMSDADEYPAMMDM
HARCVSIIANMWGAQKGEKAIGSATTGSSEAIHLGGLAMKRRWQEKRRAEGKDTSNPNII
MGANAQVALEKFARYFEVESRILPVSEDSSYRLDPKLVKENIDENTIGVFVILGSTYTGH
YEPVEEISDILDAFEKETGNDIPIHVDAASGGFIAPFTHAEAGKKWNFELPRVKSINTSG
HKFGLVYAGVGWIIWRDESYLPKHLIFELHYLGGTEESYTLNFSRPGAQIIAQYYNLIHL
GFSGYRAIMENMLANARLLSRALEHTGWYRCVSDIHRKKGDLKFEQGKKPYEEGETSADY
NAGLPVVAFTLTDEFHKEFPHVKQEAVSNLLRAKQYIIPNYPLPPGEEKTEILRVVVRES
LSLDMIDRLVTDICGVTEMLMKTDAVDLSAFQPGASPSIEKQHANKGLRKEHKHKAQRPS
SDGVYRTVC
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggccgggctcgcgagacatgtagacacggatgagctccttgagacactaaaggaccac
ccaattcacaaggccggaggacacaagtccgcgaaccgagcaacctcacatatcacacct
tactcaagtcgctatgccgctggcaccgagttgtcgaaattcaaaatcccgcacgatggc
gctcctgccgatgttgtccaccagctactcaaggacgagcttgatcttgacggacgaccc
cagttgaacttggcttcattcgtcggaacgtacatggagaaggaggccgaacagctcatg
attgagaatttgtcgaagaacatgtcggatgctgacgagtacccggcaatgatggacatg
cacgcacgatgtgtatccatcattgctaacatgtggggagcacagaagggcgagaaggcc
atcggatcggcaactactggttctagcgaagctatacaccttggtggacttgccatgaag
cgtcgctggcaagagaagagaagggctgagggcaaagacacttcaaatccaaacatcatc
atgggcgcaaacgcacaagtcgctcttgagaagtttgctaggtacttcgaagttgaatct
cgcattcttcccgtaagcgaagactcatcctaccgtctggacccaaagttggtgaaggag
aacatcgacgagaacacaatcggtgtgtttgtcatccttggttccacatacactggacat
tacgagcctgttgaggaaatctctgatattctcgacgccttcgagaaggagaccggcaac
gatattcccatccacgtagatgctgcatctggtggcttcatcgcccccttcacccacgcg
gaagctggcaagaagtggaactttgagctaccgcgagtcaaatccatcaacaccagtggt
cacaagtttggtctcgtgtatgctggtgtcggatggatcatctggcgagacgaaagctac
ctgcccaagcacctgatctttgagcttcactacttgggtggaacagaagagtcatacacc
ctgaacttctcacgtcctggagctcagatcatcgcgcaatactacaacttgatccatcta
gggttctcgggataccgtgccattatggaaaacatgttggctaatgcacgtctactgagc
agggcgctggagcatacgggctggtaccgttgcgtcagcgacattcaccgcaagaagggc
gatctcaagtttgagcagggcaagaagccatacgaagaaggcgaaacaagcgcagactac
aatgccggtttacccgtcgttgcatttactctcacagacgagttccacaaggaattcccc
catgtcaagcaagaagcggtcagcaatctgcttcgggctaagcaatacatcatccccaac
tacccgctgccaccaggcgaggagaagaccgaaatccttagagtagtcgtcagagagagt
ctgtcgcttgacatgatcgacaggctagttactgacatatgtggcgttacggagatgctg
atgaagacggatgcggttgatctttcggcgttccaacctggtgccagtcctagcatcgag
aagcagcatgccaataagggactgcggaaagagcacaagcacaaggcgcagagaccgtca
tctgatggcgtatatcgcaccgtctgctag

DBGET integrated database retrieval system