KEGG   Apteryx australis mantelli (brown kiwi): 106482446Help
Entry
106482446         CDS       T04298                                 

Gene name
SRM
Definition
(RefSeq) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00270  Cysteine and methionine metabolism
aam00330  Arginine and proline metabolism
aam00410  beta-Alanine metabolism
aam00480  Glutathione metabolism
aam01100  Metabolic pathways
Module
aam_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106482446 (SRM)
   00330 Arginine and proline metabolism
    106482446 (SRM)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106482446 (SRM)
   00480 Glutathione metabolism
    106482446 (SRM)
Enzymes [BR:aam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     106482446 (SRM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spermine_synth Methyltransf_31 Methyltransf_30 Plasmid_parti
Motif
Other DBs
NCBI-GeneID: 106482446
NCBI-ProteinID: XP_013795481
LinkDB All DBs
Position
Un
AA seq 180 aa AA seqDB search
MFPVLQDVIQVSKKYLPGMAVGYSSAKLTLHVGDGFEFMKQNQEAFDVIITDSSDPMGPA
ESLFKESYYQLMKTALREDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVEYAYCTIPTY
PSGQIGFMLCSKNSNTNFREPVQQLSQQQVEERSLKYYNSDIHRAAFILPEFARKALSDV
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgttccctgtgttgcaggatgtgatccaggtatctaagaaatacctcccaggaatggca
gtgggctattccagtgctaagctgaccttacatgtgggagatggttttgagttcatgaaa
caaaatcaagaagcctttgatgtgattatcacggactcgtctgaccccatgggtcctgca
gaaagtttattcaaagaatcctactaccagctgatgaagacagctctgcgagaagatggg
attctctgctgccaaggtgagtgccagtggctgcacctggatctcattaaggagatgcgt
cagttctgcaagtctctgtttcctgtggtggaatacgcctattgcaccatccccacatat
cccagcgggcagatcggcttcatgctgtgcagcaagaactcgaacacaaatttccgggag
cctgtgcagcagctctcacagcagcaagtggaggagaggagtctgaaatactacaactct
gacatccatcgagcagctttcatcctgccggagtttgcacggaaggccctgagtgatgtg
tga

DBGET integrated database retrieval system