KEGG   Apteryx australis mantelli (brown kiwi): 106482962Help
Entry
106482962         CDS       T04298                                 

Gene name
ZCCHC2
Definition
(RefSeq) zinc finger CCHC-type containing 2
  KO
K22700  Zinc finger CCHC domain-containing protein 2
Organism
aam  Apteryx australis mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    106482962 (ZCCHC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCHC zf-CCHC_2
Motif
Other DBs
NCBI-GeneID: 106482962
NCBI-ProteinID: XP_013796209
LinkDB All DBs
Position
Un
AA seq 1056 aa AA seqDB search
MVGLLDLCNPLELXXLGSCLEDLARKDYHCLRDSEAKANGLSDPGQLGDFRDPAVRSKLI
VYLALLGSENREAAGRLHRLLPQVDSILQSCPARRPQAGAAEEEGAEEEDVLVVMDGAAE
NGQAALPAAQGLGFGAQEELLLLFTMASLHPAFSFHQRVTLREHLERLQRALCGDQEEEA
FNRHQAQNDFSHNDCMSSNETSLLERTTASHDGLPMASHRPQREAVHIEKITLKGVPRKR
ADKHLEYTFKVTWSDLSVTCVTKTHQELQEFLLKLPKELSSEAFDKTILRALNQGFQKRQ
ERRHADLEPIVRQLFSNTSQAFLRNQRVYNFFQSISSESLHTHSNLQPSLKTVKAPEHFK
EDSSEASSQEEDVMQHTTVHKKHNGKSPVANTSSAKCSSLDSLNIQHSEQNGVIDWRRKS
CIVQQHPEHCTNLLDQHTGEKRGLSAVSKKKGKPQLEKEKTKKTDCRLNNGTNGVRVAAS
QHICTGTAKDLNLDTGSGHDTCGETSSESYSSPSSPRHDGRESFESEEEKDRDTDSNSED
SGNQNATRFTGYSAVSSSNMNKSSAQISSVNNENGSLSEDPLNAKFQHISFMPALHCVMH
SAAQKPEAVVPPPISADGKTMGMLVTTPVAVSPVRESANSPPGGIGPASGEPEKRLELMA
SPLPVPSTFLPHSVQPGSPALHLAIHRLKMPSPQGSSESCTVNGPQQPTGNLSIGSPNTA
FIPVHNPGSFPGSPVPTTDPITKPASQVVGLNQMVPHIEGNPGAIPQPTNLKVVLPAAGL
SAAAPPPPPASYALPGSPHATSVLPNQNTNVLNTVATSSPPQSAGLGVGQVQSTVPPAIP
THTPGPAPSPSPALTHSTAQSDSTSYINAVGNNNTNGTMLPPQQLGSGPCGSCGRRCSCG
TNGSLQINSYFYHNPLHGQVYRVPSFFTLPSLCNGSYLNQAHQSNGTQLPFFLPQSPYAN
GLMHDPVMGSQANYGMQQMAGFGRFYPVYPAPNVVANTNGSGPKKNGNVSCYNCGVSGHY
AQDCKQSSMEASQQGTYRLRYAPPPPPSNDTLDSAD
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atggtggggctgctggacctgtgcaacccgctggagctnnnnnnnctgggctcctgcctg
gaggacctggcccgcaaggactaccactgcctccgcgactcggaggccaaggccaacggg
ctcagcgaccccgggcagctcggcgacttccgcgacccggccgtgcgctccaagcttatc
gtctacctggccctgctgggctccgagaaccgcgaggccgccggccgcctccaccgcctc
ctgccccaagtggactccatcctgcagagctgcccggcacggcggccccaagcgggcgct
gccgaggaggagggggccgaagaggaggacgtgctggttgtgatggacggggctgcagaa
aatggccaggctgccctccccgccgcccagggcctgggtttcggcgcgcaggaggagctg
ctcttgctcttcaccatggcctccctgcacccggccttttcctttcaccagcgggtcacc
ctgagggagcacctggagcggctgcagagggccttatgtggggaccaggaggaggaggcc
ttcaaccgccaccaagcccagaatgacttttcccataatgactgcatgtcgagtaatgag
accagtttgttagaacgaaccacagcatctcatgatggactaccaatggcttcccataga
cctcagcgagaagctgtacacattgagaagataaccctgaaaggagtaccaagaaaaagg
gctgacaaacatttggaatacacattcaaagtaacctggtctgatctttctgtaacatgt
gtaacaaaaacacaccaggagcttcaggaattcctgctcaaacttccgaaggaactgtct
tctgaagcatttgacaagactattttaagagcactaaatcagggttttcagaagaggcaa
gaacgaaggcacgctgatctcgagcccatagtcaggcagctattttcaaatacatcacaa
gcttttctgaggaatcagagagtgtacaacttcttccaatcaatttcatcagaatctttg
cacactcacagtaacttacaaccctctttgaagacggttaaggcaccagaacacttcaag
gaggacagttcagaagcttcaagtcaggaggaagatgtaatgcaacacacaacagtccac
aagaaacataatggaaaaagtcctgttgccaacactagcagtgcaaaatgttcttcactg
gatagccttaacattcagcactctgagcaaaatggggtaatagactggagaagaaaaagc
tgtattgtccagcagcatccagagcactgtacaaacctacttgaccagcatacaggggaa
aaacgaggcctgtctgcagtaagcaagaagaaaggaaagccacagctggaaaaggagaaa
acaaagaaaactgactgccggttgaataacgggactaatggagttagagttgcagcatca
cagcacatctgcacagggacagcaaaagatctgaatttggacactggatctggtcatgat
acatgtggagaaacatcatctgaaagttacagttctccttctagtccacgacatgatggg
agggaaagctttgaaagtgaagaagaaaaagacagagatacagacagcaattctgaggac
tctgggaatcaaaatgcaaccaggtttacaggctacagtgctgtcagttcatcaaatatg
aacaaatcatctgctcagatctcttcagtgaataatgaaaatggaagcctttcagaagat
cctttgaatgcaaagtttcaacatatttcctttatgcctgccttacactgtgtgatgcac
agcgctgcccaaaagcctgaagcagttgtcccgccacccatatctgcagatggtaaaacg
atgggaatgcttgttaccacacctgttgctgtctcaccagtgagagagtctgcaaattca
cctcctggtggaataggcccagcctctggtgaacctgagaaacgccttgagctgatggct
tcccctttaccagtcccatccactttccttccacattctgtccagcctggtagcccagct
ttgcatttggcaatacacagattgaagatgccctctccacagggatcatcagaaagttgc
acagttaatggaccacagcagccaacaggcaatttaagtattggatcaccaaatactgcc
tttatcccagttcacaacccaggtagttttccaggatccccagttcctactacagatccc
atcacaaaacctgcatcccaggtggtaggactgaatcaaatggtgcctcacattgaggga
aacccaggagcaatccctcagcctaccaatttaaaggtagttcttccagcagctggtctc
tcagcagcagcaccaccacctccaccagcttcatatgctttgccaggcagtcctcacgct
actagtgtattgcccaaccagaatacaaatgtgctaaacactgtagcaacttcctcacca
cctcagtcagctggtttaggtgttggtcaggtccagtccactgttcctcctgcaatacct
acgcatacgccaggccctgcccctagcccgagccctgctttaacacacagcactgcacag
agtgacagtacatcttacataaacgctgttggaaacaacaacactaatgggacaatgtta
cctccacagcagttggggtctggtccttgtggttcttgtggacgtagatgtagctgtggg
accaatggaagccttcagattaatagttatttttatcataacccacttcatggacaagtc
tacagagttccatctttcttcactctgccatcactttgcaatggcagctacctcaatcaa
gcacatcaaagcaatggaacccaacttccttttttcctgcctcagtctccatatgcaaac
gggcttatgcatgacccagtaatggggagccaagccaactatggtatgcagcagatggca
ggatttgggaggttctatcctgtatatccagcacctaatgtagttgccaacacaaatggg
tcaggacccaagaagaatgggaacgtttcatgttacaattgtggtgtaagtggacactat
gcgcaggactgtaagcagtcatccatggaggccagtcaacaaggcacttacagactgaga
tacgcacctccccctcccccttccaatgataccttggattctgcagactga

DBGET integrated database retrieval system