KEGG   Apteryx mantelli mantelli (brown kiwi): 106484396
Entry
106484396         CDS       T04298                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04012  ErbB signaling pathway
aam04068  FoxO signaling pathway
aam04110  Cell cycle
aam04115  p53 signaling pathway
aam04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106484396 (CDKN1A)
   04068 FoxO signaling pathway
    106484396 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106484396 (CDKN1A)
   04115 p53 signaling pathway
    106484396 (CDKN1A)
   04218 Cellular senescence
    106484396 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106484396
NCBI-ProteinID: XP_013798035
LinkDB
Position
Un
AA seq 218 aa
MPKSQAMFGSWRQGGFHSAVTLLRGQALPSLATAATACFALVANVLVLLLAHGLHDTPIT
SAAFLSTATTMPLSQSRAGQQMPCSSKVCRNLFGPVDHNQLQNDFQNLLRQQLEEAQDRW
NFNFETDTPLEGRFEWERVFVDQQLLSLSKANSSESRSCSLAHKVPSKDHLGQASSEMPQ
QDSEACTASSPQRLKRRQTTVKDFYNSKRRIVPDKPKL
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcccaagtcccaggccatgtttggcagctggaggcagggaggtttccactctgcagtc
actttgctgcggggccaagccttgcccagcctggccactgcggctactgcatgttttgct
ctggtggcaaatgtgctggtcctcctgcttgctcacggcttgcacgacacccccataacc
agtgctgctttcctctccacagccaccacgatgcccctgtcacagagcagggctggccag
cagatgccctgcagcagcaaggtgtgcaggaacctctttggccctgtggatcacaaccag
ctccaaaatgacttccagaatctgctgaggcaacagctggaagaagcccaggaccgctgg
aacttcaactttgagacagatacacccttggaagggcgctttgagtgggagagagtcttt
gttgaccagcagctgctcagcctgtccaaagccaacagtagtgagagccggagctgctcc
ttggcccacaaggtaccctccaaggaccatcttggccaggcctcctctgagatgcctcag
caggactctgaggcttgcacggccagttccccgcagcgcttgaaacgcaggcagactacc
gtcaaggatttctacaactccaagcggagaatcgtccctgacaagcccaagctgtga

DBGET integrated database retrieval system