KEGG   Apteryx australis mantelli (brown kiwi): 106485143Help
Entry
106485143         CDS       T04298                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aam00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106485143 (SUV39H2)
Enzymes [BR:aam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106485143 (SUV39H2)
Chromosome and associated proteins [BR:aam03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106485143 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106485143 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo IGPS
Motif
Other DBs
NCBI-GeneID: 106485143
NCBI-ProteinID: XP_013798907
LinkDB All DBs
Position
Un
AA seq 425 aa AA seqDB search
MVASQMLDFPLPNCTYLAVLRRNEAWYVPCLASLETLQELCRKENLRCKSIGITNRNLKS
YEVEYLCDYKVDEGTEYYLVKWKGWPESSNTWEPLKNLKCPLLLQNFLSDKNEYLSRVKE
GKALKVKNHVKALKPAVADYIVKKAKQRIALQRWKEELNRKKNHKGMILVENTVDLEGPP
LDFYYINEYKPAPGINVINGITTGCECSDCPAEKCCPKEAGFLLAYNKRKKLKIQPGLPI
YECNSYCRCGPDCPNRIVQKGTPYSLCIFRTNNGRGWGVKTLQKIKTNSFVMEYVGEVIT
SEEAERRGQLYDNQGNTYLFDLDYDSDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDN
LDLRLPRIALFSTRTIKAGEELTFDYQMKGSIDLTSDSADGLSPSRKRIRTVCKCGAVCC
RGYLN
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggttgcatcgcaaatgcttgatttccccttgcctaactgcacgtatctggcggtcttg
cgaaggaatgaagcttggtatgtgccatgtctagcttcacttgagaccctccaagaatta
tgtaggaaggaaaatctcagatgtaaatccattggaatcaccaacaggaatctaaagagt
tatgaggtggaatatttgtgtgactacaaggtagacgagggcacagaatactatcttgtg
aaatggaaaggatggccagaatcttcaaatacttgggaacctttgaaaaatctgaaatgc
ccattgcttcttcaaaactttctcagtgacaagaatgaatatttatctcgggtaaaagaa
ggcaaagcactgaaagtgaaaaaccatgttaaagctttgaaacctgcagttgcagattac
attgtaaagaaagcaaagcaaagaatagctctgcagagatggaaagaagaacttaacagg
aaaaagaatcataaaggaatgattcttgtagaaaacactgtggatcttgaaggccctcct
ttagacttctactacattaatgagtataaacctgctccgggaataaatgtaataaatgga
ataacaactggctgtgaatgctctgactgccctgctgagaaatgttgtccaaaggaggct
ggatttcttttggcttacaataaacgaaagaagttgaaaatccagcctggcttgccaatt
tatgaatgcaattcgtattgtaggtgtggtcctgactgccctaataggatagtacagaaa
ggtacaccatattctctctgcatcttcagaaccaacaatggccgtggttggggagtaaaa
accctccagaaaattaaaaccaacagttttgtgatggagtatgttggagaggtgatcaca
agtgaggaagcagagagacgaggccagctctatgacaaccagggaaatacatacttgttt
gatttggactatgactcagatgaatttacagtagatgcagctcgatatggaaatgtgtcc
cacttcgtgaatcacagttgtgatccgaatcttcaggtcttcaatgtgtttattgataac
cttgatctgcgtcttcctcggatagcactgttttctacaagaaccatcaaagctggagaa
gagctaacctttgattatcagatgaagggttcaatagatctgacttcggactctgctgat
ggtcttagcccctcgagaaagaggatcagaactgtctgtaaatgcggagctgtgtgttgc
agaggctatctcaactga

DBGET integrated database retrieval system