KEGG   Apteryx australis mantelli (brown kiwi): 106485191Help
Entry
106485191         CDS       T04298                                 

Gene name
KMT2A
Definition
(RefSeq) lysine methyltransferase 2A
  KO
K09186  histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106485191 (KMT2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aam03000]
    106485191 (KMT2A)
   03036 Chromosome and associated proteins [BR:aam03036]
    106485191 (KMT2A)
Enzymes [BR:aam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106485191 (KMT2A)
Transcription factors [BR:aam03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    106485191 (KMT2A)
Chromosome and associated proteins [BR:aam03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106485191 (KMT2A)
   HMT complexes
    MLL-HCF complex
     106485191 (KMT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC SET FYRN PHD zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 PHD_2 Bromodomain PHD_4
Motif
Other DBs
NCBI-GeneID: 106485191
NCBI-ProteinID: XP_013798956
LinkDB All DBs
Position
Un
AA seq 3786 aa AA seqDB search
MEKVKKKELKSGEKRRGRPPTLTSVKFKLSQVKDASDVQKGSKEEKESLKKIKRSPSTTF
QQATKIKKLRTSKLSPLKSKFKPGAKLQIGRKSVQIVRRRGRPPSSERLKTSSTLVINSQ
LEKPQRIRKEKDGTPPLTKEEKTALRQSPRRIKPVRIIPSTKRTDAAIAKQLLQRAKKGA
QKKIEKEAAKLQGRKGRTQLKNIRQFIMPVVSAISSRIIKTPKRFIEDEDYDPPIKISRL
ESTPNSRFSATSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEMQALSEER
SNTPEVHTPLPVSQSPENDNSDRRNRRFSITERSFGQRTAKKLSALPSVPQQQSSSSPPP
PLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPTSAAPMQEKRKSILREPTFRWTSLK
HSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSTPGATAPARLFSLHS
GTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSSVGRTTAGTSATGVSSRKRKRRVFS
PIRSEPRSPSHSMRTRSGRLSTSDLTTLTPQSSVSSSLTSISVSSLATSALNSTFTFPSH
SLTQSGESAERSQRPRKQTSTPAEPFSSSSPAPLFPWFTSSPQTERGRNKDRATEELSKD
KDADKSVEKDKSREKDREREKENKRESRKEKRRKGSEIQSSSALFPVGKMPKEKVVSEDV
AASSSAKKPAGRKKSTAIDPVADVSTAALVDTTTIKTKTSKKGRGGLDKSELDLSPTVPS
LEKEKALRLSTPSSSTVKHSASSISSMLAQADKLPMTDKRVASLLKKAKAQLYKIEKSKS
LKQADQPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEERE
KILSSMGNDDKSSIAGSEEAEPLAPPIKPIKPVTRNKAQQEPPVKKGRRSRRCGQCSGCQ
VPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAAKKKEKKSKA
NEKKESHSGKNQLDSGQKQAPQTVLAREDNTVKKSSEPARKPVEEKHEDGNSCVPVMEPK
QVPASGARRTGKQAPQLVQLPSSQPPSSGPLKKEAPKLTTSEPKKKQAPQPEIGTEQSKQ
KKIAPRPTFPVKQKPKEKEKPPPISKPESSTLNLLSTLTNGNSSKQKAPTDGVHRIRVDF
KEDCEVENVWEMGGLGIVTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEESER
PLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVW
ICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKM
MQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCINCTEQHPAEWRLALEKELQVSLK
QVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQEEQQP
LDLEGVKRKMDQGGYTSVLEFSDDIVKIIQAAINSDGGQPEVKKANSMVKSFFIRQMERV
FPWFSVKKSRFWEPNKVTSNSGMLPNAVLPPSLDHNYAQWQEREENNRTEQPPLMKKIIP
APKPKGPGEPDSPTPLHPPTPPISSSDRSREDSPELNPPPDVEDNRQCALCLKYGDDSAN
DAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKSGATVGC
CLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVLRRVFVDFEGIS
LRRKFLSGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRC
VYTCKIMECRPPVIEPDINSTVEHDDNRTIAHSPVPLTETLSKDSRNTPEIVNPPSPDRP
MHSQTSSSCYYPVVSKGPRIRTPSYPSAQRSPGSRPLPSAGSPTPVTHEIVTVGDPLLSS
GLKSIGSRRHSTSSLSQQQSKLRMISPTRAGNTYSKHSVSSVSGMGSSSEHEPSVKNTDR
FVGSVNSGTPSAPVQSCSNSLSSQKTMATGGNKTYQLDAPQSTEVKHSSSSDLIAKGTPS
KGEKMKILTSKDPDCSAHSFSSGGNSKMSAQAHSSSSTELNVKIGTFQEPSGSFSSKEAI
SFPSLHQRGPRKDRDHQHMEPAQLEKTTLVEEVEARSLKSAGVNSRSPAASEQVVSVSRD
RRQKGKKLMKDSNFKEKHSLKSFTDSSQAVGSDEGNLKPEFSNQALATEQIGQRLCNNVP
AEKAGEKSPPSQGSSKGSVMQVEGASKESQAPRKRTVKVTLTPLKMEGENQSKNAQQESD
AEPQSTGAELATLTEPSSTSENPEDGSVVQGSPNEAPTQESQNNTYENLPVQDNNLMLQD
GAKAQEEGSYKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSNSTGKKRGKRSAE
GQVDGADDLSTSDEDDLYYYNFTRTVVSSNTEERLASHNLFREEEQCDLPKISQLDGVDD
GTESDTSVTATTRKVNQVAKRGGKENGTENLKLDRTEESGEKVQVTKSPAVHKPDPKIDN
CHPVSRVKTQGQDSLEAQLSSLETGRRAHASTPSDKNLLDTFNTELLKSDSDNNNSDDCG
NILPSDIMDFVLKNTPSMQALGESPESSSSELLTLGEGLGLDSNRGKDMGLFEVFSQQLP
TTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNHSRLAVISESSLSSSGE
RSILALPSTESGEKRVTVTEKSASGEGDAALLSPGVDPSPEGHMTPDHFIQGHIDAEHIA
SPPCGPVEQGHGSNQDLTRNSGTPGIQVPVSPTVPLQSQKYVPNSTDSPGPSQISNAAVQ
TTPPHLKPATEKLLVVNQNMQPLYVLQTLPNGVTQKIQLTPSVSSAQSVMETNASVLGPM
GSGLTLTTGLNPSLPSSQSLFPPASKGLLPMSHHQHLHPFSTATQTGFPPNIGSPSPGLL
IGVQPPPDPQLLVSEASQRTDLGTTASTPTAALGKKRPISRLQSRKNKKLAPSGTPSAIA
PPDMVSNMTLINFAPSQISNHPLDLGTIANSTSHRTVPNIIKRSKSGVMYFEQTSLLPQG
GTAAAVGTSPSVIGPDASHLPTGPASGLASSSSVLNVVSMQATAAPTTGGSVPGHVLGQS
SVTLTSPGLLGDLGSISNLLIKASQQSLGLQEQHMTLPPGSGMFSQLGTSQTPSTAAMTA
ASSICVLPSAQTMGMTVAQSSTDPEGSYQLQHMTQLLASKTGIASSQLDLGAASATQLSS
FPQLVDVPSNTGLEQNKVSSSVMHASSASPGGSPSSGQQSASSSVLGPTKLKPKIKRIQP
SSDKGNGKKHKTSHVWTSSYEAHIPDRGALAISQVSATGTPATKTDMQDAASVDQPSQKQ
CGQSAGQMAVLPESQSAQNLAKEQENAGSKALEEEESTFSSPLMFWLQQEQKRKECLGEK
KPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGII
HDTVVFLIEQLYGAKHCHNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLAS
KHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGL
FCKRNIDAGEMVIEYSGNVIRSILTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAAR
FINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKK
CRKFLN
NT seq 11361 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtaaagaagaaggaattgaaaagtggggaaaaaagacgaggaagacctcca
acacttactagcgtgaagttcaaattgtcacaagtaaaggatgcatcagatgttcagaag
ggaagtaaagaggaaaaagaaagtctgaaaaaaattaaaaggtcaccatccactacattt
cagcaagcaacaaaaatcaagaaattaagaactagtaaactctccccactaaaatctaaa
tttaagcctggggcaaaacttcagattgggaggaaaagtgttcagattgtacgcaggaga
ggtaggccgccatcttctgaacgtttaaagacttcctcgaccttagtcattaattcacag
ctggagaaaccccaaaggatacgtaaagagaaggatggcacaccacctcttacaaaagaa
gaaaagactgctctcagacagagtccacgcaggattaagcctgttaggattataccttcc
acaaaaaggacagatgcagcaattgcaaagcaactcttgcagagagctaaaaagggggcg
caaaaaaagattgagaaagaggcagctaaactacagggcagaaaggggagaacccagcta
aaaaatatccgacagttcatcatgccagttgtgagtgctatctcttcacgtattattaaa
acacccaagcggttcattgaagatgaagactatgatcctcctattaaaatatccagacta
gaatccacaccaaacagcaggttcagtgctacatcttgtggttccagtgaaaaatccagt
gctgcttctcagcattcgtctcagatgtcttcagactcttcacggtccagtagccctagc
gttgatacatctacagactctcaggcttctgaagagatgcaggcactttctgaagaacgg
agtaatactccagaagttcacacacctctgcctgtttctcagtcccctgaaaatgataac
agtgacaggagaaacagaagattttcaataacagaaagaagttttggccagaggactgct
aaaaagctgtcagccttaccaagtgtgccgcagcagcagtcctcctcttctcctcctccc
cctttgctcactcctcccccaccactgcaacctgcttccagcatctcagaccatacccct
tggcttatgcctccaaccataccattagcctcaccgtttcttcctacttctgctgcacca
atgcaagagaaaaggaaatcaattctgcgagaaccaacgtttagatggacctctctaaag
cattccaggtcagaaccgcagtacttctcatcagcaaaatatgccaaagagggtcttatt
cgcaaaccaatatttgataacttcagacccccaccactgacgccagaggatgttggcttt
gcatctggcttctcaacaccaggtgctacagctccagcacgtttgttttctctacattct
ggaacaagatttgatatgcacaagagaagtcctctgttgagagctccgagattcactcca
agtgaggcccactccagaatctttgaatctgtaactttgccctcatcggttggtcgaacc
actgcaggaacttctgcaacaggtgtatcttctagaaaacgaaagagaagagtgtttagt
cctatccgatcagaacccagatctccttcgcactccatgaggacaagaagtgggagactt
agtacctctgacctgacaactctcaccccacagtcttctgtctcttcctcattaactagc
atttctgttagttctcttgccactagtgccttaaattcaacttttacttttccttctcat
tccctaacacagtctggggaatcagcagagagaagccagagaccaaggaagcagactagc
actccagcagagcctttctcatctagtagtcctgctcctctctttccctggttcacgtca
agtccccagacagagagagggaggaacaaagacagggctacagaggaactgtccaaagat
aaagatgctgacaaaagtgtggagaaggacaagagcagagagaaagacagagagagagaa
aaggaaaacaaacgggagtcaaggaaagagaaaaggagaaaagggtcagaaattcagagc
agctctgctttgtttcctgtaggtaaaatgcccaaagaaaaagttgtcagtgaagatgtt
gcagcatcatcttcggcaaaaaaacctgctgggcggaaaaaatctacagcaatagatcct
gtggcagatgtttccactgctgctctggtagatacgacaaccatcaaaaccaaaacatcc
aagaaaggtagaggggggttagacaaatcagaactggacctcagccccactgtgccatct
ttggagaaggaaaaagctctgcgtctttctactccttcgtcaagcactgtcaaacattcc
gcttcctccatcagctctatgttggctcaagcagacaaactgccaatgactgacaaaagg
gtagccagtctcctgaaaaaggcaaaagcccagctgtacaagattgagaagagcaagtcc
ctcaaacaagcagatcagccaaaagcacagggacaagagagtgattcatcagaaacatca
gttcgaggaccacgaataaaacatgtttgcaggagagcagctgttgcactgggccgtaag
cgagcagtgtttcctgatgacatgcccactctgagtgccttaccatgggaagaacgagag
aagatactgtcttccatggggaatgatgataagtcatcaatagctggctcggaagaggct
gaacctcttgctccacctatcaaaccaattaagccggttaccagaaacaaggctcagcaa
gaacctccagtgaagaagggccgacgctcaaggcgctgtgggcagtgttcaggctgtcag
gttccagaagactgtggtgtctgtactaactgtctagacaaacccaagtttggtgggcgc
aatataaagaagcagtgctgcaaaatgaggaagtgtcagaatctacaatggatgccttcc
aaagcatatctccagaagcaagctaaagctgcaaaaaagaaagagaagaaatccaaggca
aatgaaaagaaagaaagccattctggaaagaaccagttggactctggacagaaacaagct
cctcagactgttttagccagagaagataataccgtgaagaagagcagtgagcctgcccgt
aagcccgttgaggagaagcatgaggatgggaattcctgtgttccagtgatggagcccaaa
caggtccctgcctctggtgccagaaggactggcaaacaggcaccccagctggttcagctc
ccttcttctcagccaccaagctcaggacctttgaaaaaagaagcacctaaacttaccact
tctgagcctaagaaaaagcaggctccacagccagaaataggcacagaacaaagcaaacag
aagaaaattgctcctcgtccaactttccctgtgaaacagaaacctaaagaaaaggaaaag
ccccctcctatcagcaagccagaaagcagcacgctgaatttgctcagtactctgactaat
ggaaacagttccaagcaaaaagcacctacagatggagtccatagaatccgagtggatttc
aaggaggactgtgaagtggagaatgtttgggagatgggtgggttaggcatcgtgacctcg
gtacctattactcccagggtggtctgttttctctgtgccagcagtggacatgtggagttt
gtgtattgtcaggtctgttgtgagcccttccacaagttctgcttagaggagagcgagcgg
cccctggaggaccagctggaaaactggtgctgccgtcgctgcaagttctgccacgtgtgt
gggagacagcaccaggccaccaagcagttgctggagtgtaacaagtgccgaaacagctat
caccctgagtgcctgggcccaaactacccaacaaaacccacaaagaaaaagaaagtttgg
atatgtaccaaatgtgttcgctgcaagagctgtggatcaacaacaccaggcaaagggtgg
gatgcgcagtggtctcatgacttctcactgtgtcatgattgtgccaaactctttgctaaa
ggaaacttctgtcctctctgtgacaaatgctatgatgatgatgactatgagagtaagatg
atgcagtgtggaaaatgtgaccgctgggtccactccaaatgtgaaaacctttcagacgaa
atgtatgagatactctctaacttgcctgagagcgtagcatacacctgcattaactgtaca
gaacagcatcctgctgaatggcgtctcgcgctggaaaaggagctgcaggtttctttaaag
caggttttaacagccctgttgaattctagaactactagccatttgctgcgttacagacag
gcagccaagccacctgatttaaatcctgagacagaagagagtatcccatctagaagctct
cctgaaggtcctgatcctcctgtcctaacagaagtcagtaaacaggaggagcagcaacct
ctggatctggaaggagtaaaaagaaaaatggatcaaggaggttacacttctgtgttggaa
tttagtgatgatattgtgaagataattcaagcagccattaattcggatggagggcagcca
gaagttaaaaaagccaatagcatggtcaagtccttctttattcggcaaatggagcgtgtt
tttccatggttcagtgtaaaaaaatccagattttgggagccaaataaagtaacaagcaac
agtggtatgttgccgaatgcggtgctgcccccttcgcttgaccataattatgctcagtgg
caggagcgtgaagagaacaaccgcactgaacaaccccctctgatgaagaaaatcattcca
gctccaaaacccaaagggcctggagagccagattcaccaactcctctgcatcctcctaca
ccacctatctctagttctgacagaagcagagaggatagtcctgaacttaatccacctcca
gatgtagaagacaacaggcagtgtgcattgtgcctgaaatatggtgatgatagcgctaat
gatgctggacgtcttctctatattggccaaaatgaatggacacatgtgaactgtgcttta
tggtcagcagaagtatttgaggatgatgatggttctctgaaaaatgtgcatatggctgtg
atcaggggaaagcagctgagatgtgagttctgccagaagtcaggtgccacagtaggctgc
tgcctcacttcctgtacaagtaactatcactttatgtgctcacgggccaagaactgtgtc
tttctggatgataagaaagtttactgccagaggcaccgtgacttgatcaaaggagaggtg
gttccagagaatgggtttgaagttcttaggagagtttttgtggattttgaagggatcagt
ttgagaagaaaatttcttagtggcttggaaccagagaacatccacatgatgattggttca
atgactatagactgtttaggaattctgaatgacctctcagactgtgaagataagttgttt
cccattggctatcagtgctcaagggtgtattggagcacaacagatgccaggaaacgctgt
gtgtatacctgcaagatcatggaatgccgacctcctgttatagaacccgatatcaacagc
actgtagaacatgatgataacagaacaattgcccatagtccagtacctcttacagagact
ctctccaaagacagcagaaatacacctgaaattgtaaatccaccatcaccagatcgtcct
atgcattctcaaacatctagttcctgttactatccagtggtctcaaagggtcctaggatt
aggacaccaagttatccatctgcacagaggtctcccggctctaggcctttgccttctgca
gggagtcctaccccagtgacccatgaaatagtgacagtaggagatcctttactatcctct
ggacttaagagcattggttctaggagacatagcacctcttctttgtcacaacagcagtca
aaactccggatgatttcacccacaagggctgggaacacttattccaagcacagtgtatct
tcagtttcaggcatggggtcctcttcagaacatgaaccaagtgtaaaaaatactgaccgc
tttgtgggatcggtgaattcaggtactccaagtgctccagttcaaagctgctctaacagt
ttgagctcccagaaaacaatggctacaggtggaaataaaacctaccagctggatgcacct
cagtccacagaagtaaaacattctagtagttcagatctgatagccaaaggaacaccttca
aagggagagaagatgaaaattctgacctctaaggacccagattgttcagctcatagtttt
tcttctggaggaaattctaaaatgtctgcccaagcacacagttcatcaagcacagaatta
aatgttaaaataggaacctttcaggaaccttcaggatcattttcttccaaagaagcaata
tcctttccgtctttgcatcagagaggcccaaggaaagacagagaccaccagcatatggag
cctgcacaactagagaaaactactttggttgaagaggtggaagcaaggagcttaaagtct
gcaggtgtaaacagcagatctcctgcagcaagtgagcaggtggtttctgtctctcgagac
aggcggcagaaggggaaaaagttaatgaaagattctaattttaaagagaaacattccttg
aaatcttttacagattcaagtcaagcagtaggcagtgatgaaggaaacttgaagccagaa
tttagtaatcaggctttggcaactgaacaaattggtcagaggttatgtaataatgttcct
gctgaaaaagctggtgagaagtctccaccttcacaagggtcatctaaaggttctgtgatg
caggttgaaggggcctctaaggagtcacaagcacctagaaaacgcaccgttaaagtcact
ctgactcctctcaagatggaaggtgaaaaccaatctaaaaatgcacagcaggaaagtgac
gctgaacctcagtctacaggggcagaactggccactttgacagagccctcctcaacctct
gaaaacccagaagatggctctgtagttcagggaagtccaaatgaagcaccaacacaggaa
tcccaaaataatacatatgagaatttacctgttcaagataacaacttgatgcttcaggat
ggagctaaagctcaagaagaaggctcgtacaagcggaggtatccacggagaagtgctcgg
gccagatctaatatgttctttggattgactcctctgtatggtgtgaggtcttatggagag
gaggacattccattctacagcaactcaactgggaagaagcgagggaagcggtccgcagaa
ggacaagtggatggtgcagatgacttgagtacatcagatgaagatgacttatactactat
aatttcactagaacggtggtttcctctaacacagaagagaggcttgcatcccataactta
ttcagggaagaagaacagtgtgatcttcccaaaatctcacagttagatggggtagatgat
ggaactgaaagtgatacaagtgtcacagcaacaacaagaaaagtaaatcaagtagctaaa
aggggtggtaaagaaaatggaacagaaaacttaaagctagatcgaactgaagaatctgga
gagaaagtacaagtcactaagagccctgctgtccacaaacctgatccaaagattgataat
tgccatcctgtgagcagagttaaaacacaaggccaggattcactggaagctcagctgagc
tcattagaaacaggccgtagggctcatgccagcacaccttctgataagaacttactggat
acttttaacacagaacttctgaaatctgactctgacaataacaacagcgatgactgtgga
aacatcctcccttcagacatcatggactttgttctaaagaatacaccatctatgcaggca
ttaggagaaagtccagagtcatcttcatctgaacttctaacacttggagaaggcttaggt
ctcgatagtaaccgtggcaaggatatgggtttgtttgaagttttctctcaacagctgcca
actactgaaccagtggatagtagtgtttcttcctctatatcagcagaggagcaatttgaa
ttaccattagaacttccttctgatctctccgttctgactactcgcagccctacagtgcct
agccaaaatcacagtagacttgctgtcatttcagagtcttcgctctcctcttcaggagag
aggtcaatacttgccttgccttccacagaatctggggaaaaaagagttacagttacagaa
aaatctgcctcaggtgaaggtgatgcagctcttctaagtccaggagtagaccctagccct
gaaggacatatgactcctgatcactttatccaaggtcacatagatgcagaacatatagcc
agcccaccctgtggcccagtcgagcaagggcatggcagcaaccaggatttaactagaaac
agtggaactccaggtatccaagtgccggtatcgccaactgttccccttcagagccagaag
tatgttccaaattccaccgacagtcctggtccctctcagatttctaatgcggcagtacag
acaacaccacctcatctcaaaccagccacagaaaagcttttggtagtcaatcaaaatatg
cagccactctatgtcctccaaacactccctaatggcgttactcaaaaaatacagttaaca
ccttctgttagttctgcgcagagtgtaatggagactaacgcttcagtgctagggcccatg
ggaagtgggcttacactgaccacaggattaaatccaagtttaccctcatctcagtcatta
ttccctcccgctagcaaaggattgttgcccatgtcccatcaccagcatttacatcccttc
tccacagccactcagactggcttcccaccaaatattggcagtccttcaccaggtcttctt
attggtgtgcaaccgccccctgatcctcagctgttagtgtctgaagctagtcagaggaca
gaccttggcaccactgcttctacgccaactgctgccctgggcaagaaacggccgatatct
cgtttgcagtcacggaagaataaaaagctggctccctctggaaccccttctgctatagct
cctcctgatatggtctccaacatgactttaattaattttgctccttcccaaatttcaaac
cacccactggatttgggaaccattgcaaattcaacatcccataggactgtccccaatatt
atcaaaagatccaagtctggagtcatgtattttgagcaaacatctttgctcccacaaggt
gggactgctgctgcagttggcacatctcccagtgttattgggccagatgctagtcacctc
ccaacaggacctgcatcaggactagcgtccagttcctcagtactgaatgtagtatccatg
caggccacagcagcccccactactggtgggtcagttcctggtcatgttctggggcaaagt
tcagtaacattaactagcccgggattattgggggaccttggttcaataagcaacctcttg
atcaaagctagtcagcaaagccttggtcttcaggagcagcacatgactttaccaccaggt
tccgggatgttttcacagctgggaacatcacaaactccatcaacagcagcaatgacagct
gcatcgagcatatgtgttctgccttcagcacagactatgggcatgacagttgctcagtca
tctactgacccagaaggctcctaccagcttcaacatatgacgcaactcttagccagcaaa
actgggattgcttcctcccagctagaccttggcgcagcttcagcaactcagttgtcaagc
tttccgcagctggttgatgttcccagtaatacaggacttgagcaaaacaaggtttcctcc
tctgtaatgcatgccagttcagcatctcctggaggctccccgtcatctggtcaacagtct
gcgagtagctctgtgcttggtcccacaaaactgaagccgaaaattaaacgcattcagcca
tcttcagacaaagggaatggaaagaagcacaaaacttctcacgtgtggaccagttcctat
gaagcacacattccagacagaggggcccttgctatatcccaggtctcagctacagggact
cctgctacaaagacagatatgcaggatgcagcaagcgtagatcagccatcacagaaacag
tgtgggcagtctgcagggcaaatggctgtcctcccagagtctcaatcagcacaaaacttg
gcaaaggagcaagaaaatgcaggctcaaaagctcttgaggaagaagagagcactttcagc
tccccacttatgttttggcttcagcaagaacaaaagaggaaggagtgtcttggtgagaag
aaaccaaagaaaggtttggtttttgagatctcaagcgatgatggctttcagatttgtgca
gaaagtattgaagatgcctggaaatcactgactgataaagttcaagaggcccgttccaat
gcccgcctgaaacagctatcttttgcaggtgtgaatggtttgaggatgctggggattatc
catgatactgttgtgtttctgattgagcaactttatggagcaaagcactgccacaactac
aagttcagatttcataagccggaggaagccaatgaacctcctctgaatccgcatggctct
gctagggctgaagtccacctgaggaaatctgcattcgatatgtttaatttcttggcttct
aaacaccgacagccgccagaatacaatccaaatgatgaggaagaggaggaggtacaactg
aaatcagcccggagagcaactagtatggatctgccaatgcccatgcgattccgacacttg
aagaagacctccaaggaggcagttggtgtctacaggtctcccatccatggccggggactg
ttctgcaaaaggaacattgatgcaggtgagatggtgattgaatattcaggcaatgtcatt
cgctccatcctcactgacaaacgggagaagtactatgacagtaagggaatcggttgctat
atgttccgcattgacgactctgaagtggtggatgccaccatgcatgggaatgcagcccgc
ttcatcaatcactcctgtgagcccaactgctactcccgggtcatcaacatcgatggtcag
aaacacattgtcatcttcgccatgcgcaaaatctaccgtggggaagagctgacatatgac
tacaagttccccattgaagacgccagcaacaaactgccctgtaactgtggcgccaagaag
tgcaggaagtttttaaactag

DBGET integrated database retrieval system