KEGG   Apteryx mantelli mantelli (brown kiwi): 106485953
Entry
106485953         CDS       T04298                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
SSDB
Motif
Pfam: RA DUF5111
Other DBs
NCBI-GeneID: 106485953
NCBI-ProteinID: XP_013799906
LinkDB
Position
Un
AA seq 180 aa
WGRRTPKGAHNLPPSVCRRGRSCQAALLQDEPSEWERPELDQAQVEQKIKEYNSQINSNL
FMSLNKDGSYTGFIKVQLKLVRPVSVPATKRPPCMHDARKGQRAQAVKRRTSFYLPKDTV
KHLHIISHTRASEVIDALLRKFMVVDNPRKFALFERCEKDEQGSRAGRGARAGRPLGAGT
NT seq 543 nt   +upstreamnt  +downstreamnt
tggggccgccgcacacccaagggtgcccacaacctgccgccctcggtgtgccggcgcggg
aggtcatgccaggccgctctcctgcaggatgagccgagtgagtgggagaggccagagctg
gaccaggcgcaggtggagcagaagatcaaggagtacaacagccagatcaacagcaacctc
ttcatgagcctgaacaaggacggctcttacacgggcttcatcaaggtgcagctgaagctg
gtgcggcctgtctccgtgccggccaccaagaggcccccgtgcatgcacgacgccaggaag
gggcagcgcgcccaggctgtgaagcgccgcacctccttctacctgcccaaggacaccgtg
aagcacctgcacatcatctcgcacacccgggccagcgaggtcatcgacgccctgctcaga
aagttcatggtggtcgacaacccccgcaagttcgccctcttcgagcggtgcgagaaggat
gagcaaggtagccgtgcggggcgcggggcgcgcgcggggcggcctcttggtgccgggacc
tga

DBGET integrated database retrieval system