KEGG   Apteryx australis mantelli (brown kiwi): 106486003Help
Entry
106486003         CDS       T04298                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00052  Galactose metabolism
aam00500  Starch and sucrose metabolism
aam01100  Metabolic pathways
aam04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106486003
   00500 Starch and sucrose metabolism
    106486003
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106486003
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aam04147]
    106486003
Enzymes [BR:aam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106486003
Exosome [BR:aam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106486003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 DUF5110
Motif
Other DBs
NCBI-GeneID: 106486003
NCBI-ProteinID: XP_013799968
LinkDB All DBs
Position
Un
AA seq 241 aa AA seqDB search
MRKALYLRYSLLPYLYTLFHKAHSAGETVARPLFLEFPKDPNTWTVDHQLMWGAGLLITP
VLEAGKTKVSGYFPAGTWYSLAGDSTIHSKGQWILLPAPLDTINVHVRAGHILPLQEPAF
RTVESRKKGMTLTVALTTDGFARGDLFWDDGESLQTFENGDYTQILFLATHGAVLSELLR
VNGQVDGLLLKAVTVLGVTSPPQQVLANGALVDDFSYRSDTQVLTIPVSLPMWEQFAITW
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggccctctacctccgctactccctgctcccgtacctctacaccctcttccac
aaagctcattctgccggggagacagtggcgcggcctctcttccttgagttcccaaaagac
cccaacacctggactgtggaccaccagctcatgtggggtgcagggctcctcatcacacca
gtgcttgaggcaggaaagaccaaagtcagcggctacttcccagcaggaacctggtacagc
ttagctggagactcaaccatccacagcaaaggccagtggatcctcttaccagctcccctg
gacacgattaacgtgcatgttcgagcaggacacatcctgcctctgcaggaacctgcgttt
agaactgtcgagtcccggaagaaggggatgacgttgactgtggcgctgacaacagatggg
tttgccaggggtgacctgttctgggacgatggggagagcttgcagacctttgagaatggg
gactacacacagatcctcttcctggcgacacatggcgccgtgctcagtgagctcttgcgg
gtaaacggccaggtggacgggctgctgctaaaggctgtgaccgtgctgggtgtcacaagt
cctccccagcaagtcctggccaacggtgccctcgtggatgacttctcctatcgcagcgac
acccaggtgctgactatccccgtgtcgctgccgatgtgggagcagtttgccatcacttgg
tcctga

DBGET integrated database retrieval system