KEGG   Apteryx australis mantelli (brown kiwi): 106486027Help
Entry
106486027         CDS       T04298                                 

Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00590  Arachidonic acid metabolism
aam01100  Metabolic pathways
aam04370  VEGF signaling pathway
aam04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106486027
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    106486027
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106486027
Enzymes [BR:aam01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     106486027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 106486027
NCBI-ProteinID: XP_013799999
LinkDB All DBs
Position
Un
AA seq 571 aa AA seqDB search
MTAGFDRYECDCTRTGFYGENCTTPEFLTWLKLSLKPTPNTVHYILTHFRGVWNIINNIP
FLRDTIMRYVLTSRSHLIDSPPTYNSDYNYKSWEAYSNLSYYTRSLPPVGHDCPTPMGVK
GKKELPDSKVIVEKFLLRKKFIPDPQGTNVMFTFFAQHFTHQFFKTDHKKGPGFTKALGH
GVDLNHIYGETLERQLKLRLLKDGKLKYQMIDGEMYPPTVKDTQAEMLYPPHVPEHLQFS
VGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWDDERLFQTTRLILIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQEYTYQQ
FLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEY
RKRFMLKPFKSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEIG
APFSLKGLMGNAICSPEYWKPSTFGGKVGFEIINTASFQKLICNNVKGCPFTAFHVLNPE
PTEATINVSTSNAAMEDINPTLLLKERSAEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgggattcgatcgatacgagtgcgactgcacgaggacggggttttatggggag
aactgcacaacgccggagttcctcacctggctgaagctgtcgctgaaacccacgccaaac
accgtccactacattctcacccacttcagaggggtctggaatatcatcaacaacattccc
ttcttgcgggacactattatgagatatgtgctaacgtcaagatcacatctgattgacagc
ccaccaacttacaacagtgactataactacaaaagctgggaagcctattccaatctctcc
tattacacaagaagcctgccaccagtaggacatgactgcccaacaccaatgggtgttaaa
ggtaagaaggagctcccagattcaaaggtgattgtggagaaattcttgctgaggaaaaaa
tttattcctgacccacaaggcacgaatgtgatgttcacattctttgctcaacacttcact
catcagttctttaagacggaccacaagaaaggacctggcttcacgaaagctctcggccat
ggggttgacttgaaccatatttatggagagactctagagagacaacttaagctgagactt
cttaaggatggaaagctaaaataccagatgattgacggggaaatgtatccacccacagtg
aaggacacccaggcagagatgttgtaccctcctcacgttcctgagcacctgcagttctct
gttgggcaggaggtgtttggtttggtcccaggtttaatgatgtatgctacaatatggctc
agagaacacaatcgagtctgtgacatcctgaaacaggagcatccggaatgggatgacgag
cgactgttccagactactagactcatattgataggagagacgatcaagattgttattgaa
gactacgtacaacatctgagtggctaccacttcaaactgaagtttgatcccgagctgttg
ttcaaccagcgctttcaataccagaaccgcattgcagctgaattcaatactctgtaccac
tggcacccgcttctgccagacacttttcagatacacgaccaggagtacacttaccagcag
ttcctctacaacaactccataatgctggaacatggcctttcccatatggtgaagtctttc
tccaagcaaagtgctggcagggttgctgggggcaaaaatgtacctgctgcagtacagaag
gtagcaaaagcgtcaattgaccaaagcaggcaaatgagataccagtccttgaacgagtac
aggaagcgcttcatgttgaaaccgtttaaatcatttgaagaacttacaggagaaaaagaa
atggcagcagaactggaagagctttatggagacattgatgctatggagctgtatccaggc
ctcctcgtagagaagccgcgaccaggcgccatctttggcgaaacgatggtagaaattgga
gcgccattctccctgaaaggactgatgggaaacgctatctgctcccccgagtactggaag
cccagcactttcggaggaaaagtgggctttgaaataatcaatactgcctccttccagaag
ctcatctgcaacaatgtgaaaggctgtcctttcactgccttccatgtcttaaaccctgaa
cccacagaggccaccattaatgttagtacctccaacgcagcaatggaagatatcaacccc
acgttactactgaaagagcgatctgctgagttataa

DBGET integrated database retrieval system