KEGG   Apteryx australis mantelli (brown kiwi): 106486808Help
Entry
106486808         CDS       T04298                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04068  FoxO signaling pathway
aam04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106486808 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106486808 (SOD2)
Enzymes [BR:aam01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106486808 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 106486808
NCBI-ProteinID: XP_013800916
LinkDB All DBs
Position
Un
AA seq 176 aa AA seqDB search
MQLHHSKHHATYVNNLNVAEEKYKEALAKGDVTAQVSLQPAIKFNGGGHINHTIFWTNLS
PNGGGEPKGELMEAIKRDFGSFANFKEKLTAVSVGVQGSGWGWLGYNKEQGRLQIAACAN
QDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSSRYASCKK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgcaccatagcaagcatcatgctacttacgtaaacaacctgaatgttgcagag
gagaaatacaaagaggctcttgcaaaaggtgatgttacagctcaggtgtctcttcagcct
gcgattaagttcaatggtgggggtcatatcaatcacaccatcttctggactaacctttct
cctaatggaggaggagagcctaaaggagaattgatggaagccatcaagcgtgactttggt
tcctttgcgaacttcaaggagaagctgacagctgtatcagttggtgtccaaggatcaggc
tggggatggcttgggtataacaaagagcagggacgcctacaaattgcagcctgtgcaaat
caagatcctctgcaaggaacaacaggtcttattcctttgctaggaattgatgtatgggaa
catgcttattatcttcagtataaaaatgttcgacctgattatttgaaagccatctggaat
gtgatcaactgggagaatgtatcttcaagatatgcgtcctgcaaaaagtag

DBGET integrated database retrieval system