KEGG   Apteryx australis mantelli (brown kiwi): 106487123Help
Entry
106487123         CDS       T04298                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00240  Pyrimidine metabolism
aam00983  Drug metabolism - other enzymes
aam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aam00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    106487123 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    106487123 (TK1)
Enzymes [BR:aam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     106487123 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK Chondroitinas_B
Motif
Other DBs
NCBI-GeneID: 106487123
NCBI-ProteinID: XP_013801265
LinkDB All DBs
Position
Un
AA seq 207 aa AA seqDB search
MFSGKSTELMRRVRRFQLAQYQCLLVKYAKDTRYCTSGVSTHDRNTMEALPACLLKDVYQ
EALSSAVIGIDEGQFFPDIVEFCEMMANAGKTVIVAALDGTFQRKAFGSILNLVPLAESV
VKLNAVCMECYREASYTKRLGAEREVEVIGGADKYHSVCRACYFRKRPHQPGSENKENMP
MGAKQLDMAASRKIFASCLLDSNTGTK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgttctctggaaagagcacggagctcatgcggcgagtacggcggttccagctcgctcag
taccagtgcctgctggtgaagtatgccaaggacacacgctactgcacctccggagtctcc
acgcatgacaggaataccatggaggcgctccctgcctgtctcctcaaggacgtgtaccag
gaggcactgagctcggcagtcatcggcattgacgagggccagtttttcccagacatcgtg
gagttctgtgagatgatggccaatgctgggaagactgtcattgttgctgctcttgatggg
accttccagagaaaggcttttggaagcatcctgaacctggtcccactggcagagagtgtg
gtgaagctaaatgctgtgtgcatggagtgttaccgagaagcctcctatacaaaaaggctg
ggagcagagagggaggttgaagtgattggaggagcagacaagtatcattctgtctgccgt
gcctgctacttccggaagaggcctcaccaacctgggtcagaaaacaaggagaacatgccc
atgggagcaaagcagttggacatggctgcctcccggaagatctttgcttcttgtctgctg
gactccaacacaggaacaaaatga

DBGET integrated database retrieval system