KEGG   Apteryx australis mantelli (brown kiwi): 106487237Help
Entry
106487237         CDS       T04298                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04110  Cell cycle
aam04114  Oocyte meiosis
aam04120  Ubiquitin mediated proteolysis
aam04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:aam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106487237 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106487237 (CDC23)
   04114 Oocyte meiosis
    106487237 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106487237 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aam04121]
    106487237 (CDC23)
   03036 Chromosome and associated proteins [BR:aam03036]
    106487237 (CDC23)
Ubiquitin system [BR:aam04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     106487237 (CDC23)
Chromosome and associated proteins [BR:aam03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    106487237 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 ANAPC8 TPR_8 TPR_14 TPR_19 TPR_11 TPR_16 TPR_7 ANAPC3 TPR_17 TPR_12 DUF772 TPR_9
Motif
Other DBs
NCBI-GeneID: 106487237
NCBI-ProteinID: XP_013801418
LinkDB All DBs
Position
Un
AA seq 539 aa AA seqDB search
MIYLKHARXSEVLNLSLSLQEDARDLDAYTLAKSYFDLKEYDRAAYFLRGCKSQKAYFLY
MYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHKARELDGFGLYLYGVV
LRKLDLVKEAIDVFVEAAHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIY
TELQLIEEALQKYQSLIDAGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIE
NMDTFSNLLYVRSMKPELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRAL
KLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYC
LYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHE
QLNESEQAAQCYIKYIQDIYSCGEIVEHLEVSTAFRYLAQYYFKCKLWDEASACAQKCCA
FNDTREEGKALLRQILQLRNQGETSSTEIAAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgatttacctaaagcatgccagannttctgaggtcttgaacttgtctttgtctctgcag
gaggatgctcgtgatttggatgcctatacgttagccaagtcttacttcgatctaaaggaa
tatgacagggccgcatattttctgcggggctgcaagagtcagaaggcttacttcttgtat
atgtactctagatacctgtcaggagaaaagaagaaggatgatgaaacagtggatagtttg
ggacctctggaaaaagggcaggtaaaaaacgaagctcttcgagaattaagagtagagctt
agtaagaaacacaaagcacgagaactggatggatttggcctttatttgtatggtgttgtg
ctgcggaagctggacctggtgaaagaagccatagatgtatttgttgaagctgctcatgtc
ttacctttgcactggggagcctggctggaactttgcaacttgatcacagataaagagatg
ttgaagttcctgtccttaccagatacatggatgaaagagttctttcttgcacacatttat
acagagctgcagctgatagaggaggctctgcagaagtatcagagtctcattgatgcagga
ttttccaaaagcacttacatcatctctcagattgcagttgcctaccacaacatccgagat
attgacaaagctttatccatctttaacgagctaagaaaacaagacccttacagaatagaa
aacatggacactttctccaacttgctgtatgttaggagcatgaagcctgagttgagctac
ctggctcacaatctctgtgagatagacaagtatcgtgtggagacctgctgcgtaattgga
aattattatagtttacgctcccaacatgaaaaagcagcactttatttccagagagccttg
aaactaaatcctcggtatctgggagcctggacacttatgggacatgagtatatggaaatg
aagaacacatctgcagctattcaagcttatagacatgcgatagaggtgaacaaaagggac
tacagagcctggtatggcttggggcaaacctatgaaatcctcaaaatgccattttactgt
ctctattactaccgacgggcccaccagctcagacccaatgattcccgtatgctggttgct
ctaggagaatgctatgagaagctcaaccagttggtggaagctaaaaagtgctattggaga
gcctatgctgttggagatgtggagaaaatggcattggtaaaactggcaaagctgcatgaa
cagctgaatgaatctgaacaagctgctcagtgctatatcaaatacatccaggatatctat
tcctgtggggagatagtggagcacctggaggtcagtactgccttccgttacctggcccaa
tactacttcaagtgtaagctctgggatgaagcctcagcctgtgctcagaaatgctgtgca
ttcaatgatactagagaagaagggaaggccctgctgcggcagatcttgcagcttcgcaac
caaggagaaacttcgtccacagaaattgctgctccctttttcctccctgcatcactgtca
gccaacaacactcccacacgtcgtgtgtctccactcaatctgtcttctgttacaccatga

DBGET integrated database retrieval system