KEGG   Apteryx australis mantelli (brown kiwi): 106487492Help
Entry
106487492         CDS       T04298                                 

Definition
(RefSeq) neuropathy target esterase-like
  KO
K14676  lysophospholipid hydrolase [EC:3.1.1.5]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106487492
Enzymes [BR:aam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     106487492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding Patatin
Motif
Other DBs
NCBI-GeneID: 106487492
NCBI-ProteinID: XP_013801712
LinkDB All DBs
Position
Un
AA seq 1255 aa AA seqDB search
MGQSESEPQEETEDASLTAALPKLFAEEHARGDGWWHPARCRGDPFPSRSPEVPAQETPK
YRFRKRDKMLFYGRKIMRKVSQSTSSLVDTTISSTSRPRMKKKLKMLNIAKKFLRIKKEL
PTLQLKEPPPSVLEADLTEFDVANSHLPSEVLYMLKNVRVLGHFEKPLFLELCKHMIFQQ
FQQGEYVFRPGQPDTSIYVLQDGKLELFLTEPDGKETVMKEVFPGDSVHSLLSILDVITG
HQRPYRTVCARAAEDSTVLRLPVEAFSAVFEKYPESLVRVVQIIMVRLQRVTFLALHNYL
GLTNELFSHEMQPLRLFAQPSHATRTSPVRHGKRVLGAMLGLGLVVVLVAAAIAVLVRRL
RLKKVPAQETPKYRFRKRDKMLFYGRKIMRKVSQSTSSLVDTTISSTSRPRMKKKLKMLN
IAKKCWHASPMGGTGPVVAPEGAVPTVAPSPQDVSLHFVLWGCLHVYQRMIDKAEDVCLF
LTQPGEMVGQLAVLTGEPLIFTIKANRDCTFLKISKSDFYEIMREQPSVVLSVAHTVAAR
MSPLVRQMDFAIDWMAVEAXGARLWMQGDKSDCTYIVLNGRLRSVIQKGSGKKELIGEYG
RGDLIGVVEALTRQPRATTVHAVRDTELAKLPEGTLNNIKRRYPQVVTRLIHLLSQKILG
NLQQLRGPFAGSSLGMASSSEPTNPTSNLSTVAVLPVCDDVPTAAFTLELKHALNAIGPT
LLLTSDIIRARLGSSALDSIHEYRLSGWLAQQEDIHRIVLYQTDCTLTPWTVRCIRQADC
ILIVGLGEQEPALGELEQMLENTAVRALKQLILLHREDGASPCRTVEWLNMRSWCSGHLH
IKCPRRVFSRRSPAKLREMYEKVFEKNADRHSDFSRLARVLTGNTIALVLGGGGARGCSH
IGVIKAMEEAGIPIDMIGGTSIGSFIGALYAEERSAVRTKQRAREWAKCMNSVFETVLDL
TYPITSMFSGSAFNASINKVFQDKQIEDLWLPYFNVTTDITASAMRVHTDGKSSRPSRLS
LSLSSLPPPPCPCRGGGEPPRHPFFSHPAADIARNMGAKTVIAIDVGSQDETDLCNYGDS
LSGWWLLWKRLNPWAEKVKVPDMAEIQSRLAYVSCVRQLEVVKSSSYCEYIRPPIDRFKT
MDFGKFDEIYCVLHATFVPPTSPLCPPIPFLGTALGVLGPPFPPHPKVLTCPSAGFTDLA
EIVSRIEPAKSYLSDGYADEESDYLTEYEEEGPEVMRGEEEAFAPAEWPGASETV
NT seq 3765 nt NT seq  +upstreamnt  +downstreamnt
atggggcagagcgagtcggagccgcaggaggagacggaggacgcgtcgctgacggccgcg
ttgcccaagctgttcgccgaggagcacgctcgcggcgatggctggtggcacccggccagg
tgccggggtgaccctttcccttcccgctctccagaggtgccggctcaggagacgcccaaa
taccgtttccgcaagcgggacaagatgctcttctacgggcgcaagatcatgcgcaaggtc
tcccagtccacctcgtccttggtggacaccaccatttccagcacctcccgccctcgcatg
aagaagaagctcaagatgctgaatatcgctaaaaagttcctgcgcatcaagaaggagctg
ccgacgctgcagctgaaggagcctccgccctccgtgctggaagccgacctgaccgagttc
gacgtggctaattcccacctgccctccgaagtgctctacatgctgaagaacgtgcgggtg
ctgggtcacttcgagaagccgttgtttctggagctttgcaaacacatgatcttccagcaa
ttccaacagggagaatacgtcttccggcccgggcagcccgacaccagcatttacgtgctg
caggatggcaagttggagcttttcctgacggagccggacgggaaggagacggtcatgaag
gaggtattcccgggcgacagcgtgcacagcctgctcagcatcctcgacgtcatcacgggg
caccagcggccttaccggacggtgtgcgcccgggcggcggaggactccaccgtgctgcgg
ctgcccgtcgaggctttctcggccgtcttcgagaaataccccgagagcctggtgcgggtg
gtgcagatcatcatggtgcgcctgcagcgcgtcaccttcctggccctgcacaactacctg
gggctcaccaacgagctcttcagccacgagatgcagccgctgcggctcttcgctcagccc
agccacgcgacccgcaccagccccgtgcgccacggcaagcgggtgctgggggcgatgctg
gggctcggcctcgtcgtggtcctcgtcgccgctgccatcgcggtgctggtccgcaggctg
cgtctcaagaaggtgccggctcaggagacgcccaaataccgtttccgcaagcgggacaag
atgctcttctacgggcgcaagatcatgcgcaaggtctcccagtccacctcgtccttggtg
gacaccaccatttccagcacctcccgacctcgcatgaagaagaagctcaagatgttgaat
atcgctaaaaagtgctggcacgcgtcacccatgggggggaccggaccggtggtggcaccc
gagggtgctgtgccaacggtggccccgtccccgcaggacgtgagcctccacttcgtgctc
tggggctgcctgcacgtctaccagcggatgatcgacaaggcggaggacgtgtgcctcttc
ctgacgcagcccggcgagatggtgggccagctggccgtgctcaccggcgagcccctcatc
ttcaccatcaaggccaaccgcgactgcaccttcctcaagatctccaagtcggacttctac
gagatcatgcgggagcagcccagcgtggtgctgagtgtcgcccacacggtggccgcccgc
atgtcacccttagtgcgccagatggacttcgccatcgactggatggcggtggaggccngc
ggggctcgtctctggatgcagggcgacaagtcggactgcacctacatcgtgctcaacggg
cgcctccgctccgtcatccagaagggcagcggcaagaaggagctcatcggcgagtacggc
cgcggggacctcatcggcgtggtggaagccctcacccggcagccccgagccaccacggtc
cacgctgtccgggacacggagctggccaagctgcccgaggggaccctgaacaacatcaag
cgcagatacccccaggtcgtcacccgcctcatccacctgctgagccagaagatcctgggg
aacctgcagcagctccggggccccttcgcaggctccagcttgggcatggcctccagctcg
gagcccaccaaccccaccagcaacctgtcgacggtggcggtgctgccggtgtgcgacgac
gtgcccacggccgccttcaccctggagctcaagcacgcgctcaacgccatcggtcctacg
ctgctcctcaccagcgatatcatccgcgcccggcttggctcatcggcactagacagcatc
cacgaataccgcctgtcgggctggctggcccagcaagaagacatccaccgcatcgtgctc
taccaaaccgactgcaccctgacgccctggaccgtgcgctgcatccggcaggcagactgc
atcctcatcgtggggctgggagagcaggagccggcgctgggagagctggagcagatgctg
gagaacacggccgtgcgcgccctgaagcagctgatcctgctgcaccgcgaggacggcgcc
agcccttgccgcaccgtcgagtggctcaacatgcgcagctggtgctccggccacctgcac
atcaagtgtccccggcgcgtcttctcccgccgcagccccgccaagctgagggagatgtac
gagaaagtgtttgagaaaaacgccgatcggcacagcgacttctcccgcctggcgcgggtg
ctcaccggcaacaccatcgccctggtcctgggtggaggcggcgccaggggctgctctcac
atcggggtgatcaaggccatggaggaggcgggcatccccatcgacatgatcggcggcacc
tccatcggctccttcatcggcgcgctctacgccgaggagcgcagcgccgtgcgcaccaag
cagcgggcccgcgagtgggccaagtgcatgaattcagtgttcgagaccgtcctggacctc
acctatcccatcacctccatgttttcgggctcggccttcaacgccagcatcaataaggtt
ttccaggataagcagatcgaggacctgtggctgccctacttcaacgtgacgaccgacatc
acggcctcggccatgcgggtgcacacggacggtaagagctctcgtccctctcgtctctcc
ctgtccctctcgtctctccccccaccgccctgtccgtgccgggggggaggtgagccgccc
cgacacccgtttttctcccatcccgcagccgacatcgcccgcaacatgggtgccaagacg
gtgatcgccatcgacgtgggcagccaggacgagacggacctgtgcaactacggcgacagc
ctctcgggctggtggctcctctggaaacgcctcaacccttgggccgaaaaagtcaaggtc
cccgacatggccgagatccagtcgcgcctggcctacgtgtcgtgcgtgcggcagctggag
gtggtcaagtccagctcctactgcgagtacatccggccccccatcgaccgcttcaagacc
atggatttcggcaagttcgacgagatctattgcgtcctccatgccacctttgtccccccc
acatcccctctctgtccccccatccccttcttggggacagctctgggcgtcttgggaccc
ccttttcctccccacccgaaggtgctgacgtgccccagcgccggcttcacggacctggcg
gagatcgtgtcccgcatcgagcccgccaagagctacctgtcggacggttacgcagacgag
gagtccgactacctcaccgagtacgaggaagaggggccggaggtgatgcggggcgaggag
gaggccttcgccccggccgagtggcccggggcctccgagacggtg

DBGET integrated database retrieval system