KEGG   Apteryx australis mantelli (brown kiwi): 106487728Help
Entry
106487728         CDS       T04298                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00052  Galactose metabolism
aam00500  Starch and sucrose metabolism
aam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106487728
   00500 Starch and sucrose metabolism
    106487728
Enzymes [BR:aam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106487728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 106487728
NCBI-ProteinID: XP_013801977
LinkDB All DBs
Position
Un
AA seq 888 aa AA seqDB search
MGRVKSLCFLAVVLAVLGQSFCSDEDPQCSRDVPVKSRIDCHPQPGASQEKCEARGCIWC
STNMPNAPWCFFPEDSPYGYSLNGNAEKTAKGWRLTLNKLQALSLFGNDISPVVIDVEFQ
TRDRLRFKIYDPNRQRFEVPLKVESPSVAADDTSYDIEVADDTSHFRIKRKSTGTVLWDA
SLSDLIFSNQYLQITTTVPSTSVYGFGEHEHLSFKHSMNFATYGMFSRDQSPTPFANLYG
VHPFYMCVETDSNAHGVLLLNSNAQDVSLSPNPSLTFRTIGGVLDFYVFLGPTPENVIQQ
YTEAIGRPHMPAYWSLGFQLSRWGYGSIDVLKKTVDRMHYYDIPYDVQHSDIDYMERRLD
FTYDKVNYAGLPEYMQQLKKEGMHYVLILDPFISKDEEPGTYRPYDLGEEMGVWVNNSDG
VTPAVGKAWPDGHSVFPDYTNPRTVDWWTQMCLELKDVLDYDGIWIDMNEPSNFDRGQYP
GCAVNDVNNPPYIPSISDRALAQKTLCPDSKTYLGEHYNTHSLFGWSQTAPTFHATQKAT
GKRAFVLSRSTFVGSGKHGGHWLGDNFSQWKDMHLSIIGILEFNLFGIPYIGADICGFNY
NTTYELCLRWMQLGSFYPFSRNHNAEKNSEQDPAAFGAEFAKISRETLRIRYSLLPYLYT
LFFESHVHGNTVARSLMHEFTSDQKTHEIDTAFLWGPAFMIAPVLQEGARSVDVYFPEAP
WFDYYTGNKVPASWLKNYATVDAPLSKIPLFLRGGYILPKQAPATTTTKSRLNPFGLIIA
LDDQGEASGSLFWDDGDSIDSIEKEIYFLAKYTFSKGHLKTEIVKNGYRGADSLKYNTIT
ILGLRLRPHAVALNGRTVRGDAFSYQTNGKLTLWLSAALTQELNIAIY
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atggggagagtcaagagtctctgtttcttggctgttgtgctagcagtcctaggacagagc
ttttgctccgatgaagacccacaatgttcccgggatgttccagttaagagccgcatcgac
tgccacccacagcccggggcttcccaggagaaatgcgaagcaaggggctgcatttggtgt
tccaccaacatgccaaatgccccctggtgcttcttcccagaagacagtccctacggctat
tctctaaatgggaatgcagaaaagacagctaaaggctggaggttaacgctgaacaaactc
caggcattgtcgctgtttggaaatgacatttctcctgttgtcatagatgtggagttccag
acaagagacagactcaggtttaaaatttatgatcctaaccgccagcgatttgaagttcca
ctcaaggttgaatccccttctgttgctgctgacgacaccagctatgacattgaggttgcc
gatgatacctctcacttcagaatcaagaggaaaagcactggcacagtactgtgggatgca
tccctgtctgatctgattttttccaaccagtatctacagattacaactacagtgccatcc
acctcagtgtatgggtttggtgaacatgagcacctgtccttcaaacacagcatgaacttc
gctacctatggcatgtttagcagggatcagtcaccaacgccatttgccaatctttatgga
gttcaccctttctatatgtgcgtagagactgactccaatgcccatggcgttctccttctg
aattccaatgcacaagatgtttctctgagtccaaatccatcgttaactttccgcactatt
ggaggcgtccttgacttctatgtgttccttggaccaactcctgaaaacgtaattcagcaa
tacactgaggctattggacgcccacacatgcctgcctactggtctctggggttccagctc
tcgcgatggggttatggaagcattgatgttttaaagaaaacggttgatcgcatgcactac
tatgatatcccctatgatgtccagcattctgatattgattacatggaacgtcgtctggac
tttacctatgataaagtaaattatgccggtctgccagagtacatgcaacagctgaagaaa
gaaggaatgcactatgtcttgattctggatcctttcataagtaaggacgaagaaccaggt
acttacaggccttatgatctcggagaagaaatgggagtctgggtgaataattctgatggt
gtaactcccgctgtcggaaaggcctggcccgatggacattctgtgtttcctgactacact
aaccccaggacagttgactggtggacccagatgtgtctggagttaaaggatgtccttgac
tacgatggaatctggattgatatgaatgaaccatccaattttgatagaggccagtatcct
ggatgtgctgttaatgatgtcaataaccctccttacattcctagcatttctgatcgtgct
ctggctcaaaaaaccttgtgtcctgactccaagacgtacctgggagaacactacaatacg
cactctctctttggctggtcacagactgcaccaactttccatgctacgcagaaagcaact
ggaaagcgagcatttgtcttaagtcggtctacgttcgttggaagtgggaaacatgggggt
cactggcttggtgacaacttttcacagtggaaagacatgcacctgtcaatcattggaatt
ctggaatttaacctctttgggattccctatattggtgctgatatctgtgggtttaactat
aacactacctatgaactctgcttgcgctggatgcaacttggctctttctatccattttcc
agaaaccacaatgcagagaaaaacagtgaacaagacccagcagcgtttggagcagagttt
gctaagatatctcgagaaacgcttcggatcagatactcactgctgccatacttgtacacc
ttattctttgagtctcatgttcatggaaacacagtggcacgatcactgatgcatgaattt
acctctgatcagaagactcatgaaatagatacagccttcctttggggacctgcttttatg
attgctccagttcttcaagagggagcaagatctgtggatgtgtatttccctgaagcacca
tggtttgactactacacaggtaataaagtgccggcttcctggctcaagaactatgccact
gttgatgccccattgagcaagatccctctgttcctgcgcggaggctacattctgccaaaa
caggcaccagccacaacgacaactaagagccgtctgaacccgtttgggctcattattgcc
ctggatgatcaaggagaagcttctgggtcactcttctgggatgatggtgattcgattgat
tctattgaaaaggaaatctacttcttggctaaatatacgttcagcaaaggacacctgaag
acagaaatagttaaaaatggctaccgaggggctgactctctgaaatacaacacaattacg
atccttggtctgagactgagacctcatgccgttgctctgaacggaaggaccgtccgtgga
gatgctttctcttatcagacaaacgggaaactcactttatggctttctgcagcacttact
caggagctcaacattgcaatttactag

DBGET integrated database retrieval system