KEGG   Apteryx mantelli mantelli (brown kiwi): 106488178
Entry
106488178         CDS       T04298                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04010  MAPK signaling pathway
aam04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106488178 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106488178 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aam04052]
    106488178 (KITLG)
Cytokines and growth factors [BR:aam04052]
 Growth factors
  Growth factors (RTK binding)
   106488178 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 106488178
NCBI-ProteinID: XP_013802486
LinkDB
Position
Un
AA seq 328 aa
MANQFSYLIAVSGNASSINRSRFMPDVSLCSLSSIITSEAETYQLPYQTWIITCFCLQLL
LLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYIITLKYVPKMDSLPNHCWLHLMVPEF
SRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIINDLMACLAFDKNKDFIKENGHLYKEG
RFIPEDFFSHFNSTIEVYKEFADTLDQNDCILPSTVETPENDSRVAVTKTFLFPPVAASS
LRNDSIGSNTSSNKEALGFIRSSSLQGISIALTSLLSLLTGFILGAIYWKKTHPKSRAES
DETTQCNDCQEENEISMLQQKEKDHLQV
NT seq 987 nt   +upstreamnt  +downstreamnt
atggctaaccagttctcttacttgattgctgtctcaggaaacgctagttccataaaccgc
tctcggtttatgcccgatgtatcactttgttccttatcatccattataacatcagaagca
gagacttatcagctaccttaccagacttggattatcacttgcttttgtcttcaactactc
ctacttaatcctcttgtcaaagcccagagttcctgcgggaatccagtgacagatgatgtg
aatgacattgcaaaattggttggaaatctcccaaatgattatattataacccttaaatat
gtcccgaagatggatagcctgcctaatcactgttggttgcatttgatggtgcctgaattt
tcaaggagtctacataatcttctccagaaattttcagatatttcagatatgtctgatgtt
ttaagcaactattcaatcatcaataatctcacaaggataattaatgatcttatggcatgt
ctagcttttgataaaaataaggattttataaaagaaaatggtcatctttataaagaaggt
cgcttcattcctgaggatttttttagtcactttaatagtaccattgaggtctataaggag
tttgcagacacattggaccagaatgactgcattctgccttcaacagtagaaacaccagag
aatgattccagagtcgctgtcacaaaaacatttttgtttcctcctgttgctgccagctcc
cttaggaatgacagcattggcagtaacactagcagtaacaaagaagcacttggcttcatt
aggagctccagcctgcaagggatcagcatagcactgacatcactgctgtctcttcttact
ggctttattttgggagccatatactggaagaaaacacatcccaaatccagagcagaaagt
gatgaaactacacagtgtaatgactgtcaagaggaaaatgagataagtatgttgcagcaa
aaagaaaaagaccatctacaagtgtag

DBGET integrated database retrieval system