KEGG   Apteryx mantelli mantelli (brown kiwi): 106488364
Entry
106488364         CDS       T04298                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04010  MAPK signaling pathway
aam04020  Calcium signaling pathway
aam04260  Cardiac muscle contraction
aam04261  Adrenergic signaling in cardiomyocytes
aam04270  Vascular smooth muscle contraction
aam04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106488364 (CACNA1C)
   04020 Calcium signaling pathway
    106488364 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106488364 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106488364 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    106488364 (CACNA1C)
   04270 Vascular smooth muscle contraction
    106488364 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aam04040]
    106488364 (CACNA1C)
Ion channels [BR:aam04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106488364 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 106488364
NCBI-ProteinID: XP_013802673
LinkDB
Position
Un
AA seq 2220 aa
MFQAFVRQAYHPLTSHLPGEPETKYKGKLVHETQLNCFYIKPGGSNYGSPRPAHANMNAN
AAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQKKQG
TTTATRPPRALLCLTLKNPIRRACISIVEWKSFEIIILLTIFANCVALAIYIPFPEDDSN
ATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILE
QATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIAL
LVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTEC
KAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGRDWPWIYFVTLIIIG
SFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENE
DEGMDEEKPRNMSMPTSETESVNTDNVPGADIEGENCGARLAHRISKSKFSRYWRRWNRF
CRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEML
LKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITR
YWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNF
PQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIA
VDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIEKAAVEEETKEEKIELKSITAD
GESPPATKINVDDYQPNENEEKSPYPTTEAPGEEDEEEPEMPVGPRPRPMSELHLKEKAV
PMPDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSFRNQI
LFYFDIVFTVIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNIL
DLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNI
VIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTAAECRGYYITYKDGEVNQPMIQPRSWE
NSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIII
IAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKV
WYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIA
FKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVN
PAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVA
LLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLA
CLPDKKCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTR
DWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLV
SMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQV
VPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPE
IRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTT
QRPLHINKSGNNQGDTESPSHEKLVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPSY
PSTVSTVEGHGTPLSPTICVQEASWKLPSKRTHYYETLGRSSSRDSQLAIVCQEEVSQDE
TYDENLNEDMEYCSEPSLISTEMLSYQDDENRQLTPPENNKGEDTRHSPKKGFLCSSSLG
RRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTMFSRLCAT
PPATPCSRGWPQQTIPTLRLDGAESSEKLNSSFPSIHCSSRYPDDSGCSSPRRARPVSLT
VPSQTGGSNRQFHGSAGSLVEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMENA
ADNILNGNSKQSPNGNLLPFVNCRDPGQDSAGEEEEEVQNPDCRKSQEELKDSRIYISSL
NT seq 6663 nt   +upstreamnt  +downstreamnt
atgtttcaagcctttgttcggcaagcgtatcacccgctaaccagccacttgccaggggaa
cctgaaacgaagtataaggggaagctggtgcatgaaactcagctcaactgcttctacatc
aaacctggaggttccaactatgggagtccccgtccagctcatgccaacatgaatgccaat
gcagctgcagggcttgccccagagcacatccctactcccggggcagctctgtcctggcaa
gctgcaattgatgctgccaggcaggccaaattgatgggcagtgctggcaatgcaacaata
tccacggctagctccacacagagaaaacggcagcagtatggaaaacagaaaaaacagggt
accaccacagctacacgtcctccccgggcactgctgtgtttaacactgaaaaatcccatc
cggagggcatgcatcagcatcgtcgaatggaaatcatttgaaataattattttactgact
atttttgccaattgtgtggccttagctatctatatcccctttccagaagatgattccaat
gccaccaattccaatctggaacgagtggaatatctctttctcataatttttacagtggaa
gcatttttaaaagtaatagcatatggacttctctttcaccccaacgcttacctccgcaat
ggctggaatttactagattttataattgtggtagtagggctttttagtgcaattttagaa
caagcaaccaaagcagatggggggaattcaataggaggaaaaggtgccggattcgatgtt
aaagcactgcgagctttccgagtattacgtcccttacggctggtgtctggagttcctagt
ctccaggtggttttaaattcaattatcaaggccatggtccccttgttgcatattgccctg
ctggtgctgtttgtcataattatctatgccatcattggactggagttattcatggggaag
atgcataagacctgctaccatgtacaagggggactaatagatacacctgcagaagatgat
ccctctccttgtgctccccagtctgcacatgggcggcagtgtcagaacggcaccgagtgc
aaagcaggctgggagggacctaagcacggcattacgaactttgacaattttgcttttgcc
atgctgacggtgtttcagtgcatcaccatggagggctggacagatgtactgtactgggtc
aatgatgccataggaagggactggccctggatctattttgttacactaatcatcataggg
tcattttttgttcttaacttggttctcggtgtgcttagcggggagttttccaaagaaaga
gagaaggctaaggctcgtggtgatttccagaaattgcgggaaaaacaacagctagaggag
gatttgaagggatacttagactggataacacaagcagaagatattgatccagaaaatgaa
gatgaaggcatggatgaggagaagcctcgaaacatgagcatgcccaccagtgagaccgag
tccgtgaacacagacaacgtccctggagcagatattgaaggcgaaaactgcggtgctagg
ctagcgcatcgtatctccaaatctaagtttagccgctactggcgccgatggaatcgattc
tgcagaagaaagtgccgagctgctgtcaagtccaatgttttctactggttggtgatcttc
cttgtgtttctcaacactcttaccattgcctctgaacactacaaccagccagactggctc
actgaggtccaagacactgccaataaggtgctgctagctcttttcacggcagagatgctg
ctgaagatgtatagccttggtctccaggcctattttgtgtccctcttcaaccgttttgac
tgtttcattgtgtgtggaggaatcctggaaacaattctggttgagacaaagatcatgtca
ccgctgggcatttcggtgttgagatgtgttcgactcctaagaatatttaaaatcacaaga
tattggaattctctgagtaacctcgtggcttcactcctgaactcagtccgttccattgcc
tccctgttgctgcttctcttcctcttcattatcatattctcactcctgggaatgcagctc
tttgggggcaagtttaactttgatgagatgcagaccaggaggagtacatttgataacttc
ccccagtccctcctcactgtgtttcagatcctgactggggaggactggaattcggtgatg
tatgatgggatcatggcttatggcggcccctcttttccaggaatgttggtctgtatttac
ttcatcatcctcttcatctgtggaaattatatcttgctgaatgtatttttagccattgct
gtggacaaccttgctgatgctgagagtttaacatctgcacaaaaagaggaggaagaggaa
aaagaaaggaaaaaactagctaggactgctagtcccgaaaagaaacaggagatagaaaaa
gcagctgtggaggaggagacaaaggaggagaaaattgagctgaaatcaatcactgctgat
ggagagtccccacctgctaccaagatcaacgtagatgattatcagcccaatgaaaatgaa
gaaaagagcccatatcccacaacagaagcaccaggagaggaagatgaggaagaacctgag
atgcctgttggccctcggcctcgcccgatgtcggaactgcacctcaaggaaaaggctgtg
cccatgcctgatgccagcgcatttttcatcttcagtcctaacaacaggtttcgtgtccac
tgccatcgaatcgttaacgataacattttcaccaacctgatcctatttttcatcttgctc
agcagcatctccttggcagctgaggaccctgtccgacacctctcctttaggaaccaaatt
ctcttttattttgatatagtttttactgtcattttcaccattgaaattgctctgaagatc
ctaggcaatgcagactatgtcttcactagtatctttacattagaaattattcttaagatg
actgcttacggggctttcctccataaaggctccttctgcaggaactatttcaacatctta
gacctgctggtggtcagcgtttctctcatctcctttgggatccagtccagtgctatcaat
gtggtgaagatcctacgtgttctgcgagtgctcagaccactgagggccatcaacagagcc
aaaggcctaaagcatgtggtccagtgtgtgtttgtcgccatccgaaccatcggaaacatt
gtgattgtcaccactttgctgcagttcatgtttgcctgcattggagttcagttgttcaag
ggcaagttgtacagctgcactgatagctccaagcagacagcagcagaatgcagggggtac
tacattacatacaaggatggtgaggtcaaccagccgatgatccagccccgaagctgggag
aacagcaagtttgactttgacaatgtcttgactgccatgatggccctcttcactgtctca
acctttgagggatggccagagttgctgtataggtccattgattcccacatggaggatgtg
ggacccatctataatcacagggttgagatatccatcttctttattatctacatcatcatc
attgctttcttcatgatgaatatcttcgttggtttcgtcatcgtcacgtttcaggaacaa
ggagaacaagaatacaagaactgtgagctggacaaaaaccagcgccagtgtgtagaatat
gccttgaaggcccggcccctgcggaggtacatccctaaaaaccagtaccaatacaaagtc
tggtatgtggtaaactccacctattttgagtacctgatgttcgttctgatcctgctgaac
accatctgcctggccatgcaacactacggtcagagctgcatgttcaaggaagccatgaat
atcctcaacatgctcttcactggcctcttcactgttgagatggtcctgaaattaatcgcc
ttcaaacccaagggttactttagtgatccttggaatgtttttgacttcctcatcgtaatt
ggcagcattatagacgtcattctcagtgaaactaatcactatttctgtgatgcatggaat
acatttgacgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtgaac
ccagctgaacatacccaatgctcttcctctatgaacgcagaggaaaactctcgcatctca
atcaccttcttccgactcttccgcgtgatgcgtctcgtgaagctcctgagccgaggggag
ggcatccggactctgctttggaccttcatcaagtccttccaggctctcccctatgtggct
cttttaatagtgatgttgttcttcatctacgctgtgattgggatgcaggtgtttggtaaa
attgcgctgaacgataccacagaaatcaaccgcaacaacaacttccagaccttcccccaa
gcagtgttgctgcttttcaggtgtgccaccggtgaggcctggcaggaaatcatgctggca
tgtctcccagacaaaaagtgcgatccagagtcggaaccggccaactccacagaagctgat
cactcctgcgggagcagctttgctgtcttctatttcatcagcttctacatgctctgtgcc
ttcctgatcatcaatctttttgtagctgttataatggataactttgattacttgacacgg
gactggtccattttaggaccacaccacctggatgagtttaaaaggatctgggcagagtat
gaccctgaagcaaagggacgtatcaagcatttggatgtggtgacactgctccggcggatt
cagccacccctgggctttgggaagctctgtcctcatcgagtggcttgcaaacgccttgtc
tccatgaatatgccactgaatagtgatgggactgtcatgttcaatgctactctctttgcg
ttggtcagaacagcactgaggatcaagacagaaggtaacttggagcaagccaatgaagag
ctgagagcaataattaagaaaatctggaagcgcaccagtatgaagctgctggaccaggtg
gtgccccccgcaggtgatgacgaggtgactgttgggaagttctacgccactttcctaatc
caagagtatttccggaagttcaagaaacgtaaagaacagggcctggtgggcaagccttcc
cagcgcaatgctctctctctgcaggctggtctgcgcacacttcatgacattgggccagag
atccgacgagcaatctctggagacctgacagctgaagaggagctagataaggccatgaaa
gaagctgtttctgctgcctctgaagatgatatcttccggagagccggaggtttgtttgga
aaccatgtcagctattaccaaagtgatggcaggagcgcgttcccccagacgttcaccacg
cagcgacctttgcacatcaataagtctggcaacaaccagggagatactgagtctccatct
catgagaagctggtagactccactttcactcccagcagctactcatcttcaggctccaat
gccaacatcaacaatgccaacaacactgccttgtgccgcttccccagcccacccagctac
cccagcacagtcagcacagtggaaggccatggcacccccttgtcacccaccatatgtgtg
caggaggcttcttggaaactaccctccaaaaggacgcattactatgaaacactgggacgc
tccagttccagagacagccagctggcaattgtttgccaagaggaagtttctcaggatgag
acttatgatgaaaatttgaatgaagacatggagtactgtagtgaaccaagcctgatctct
actgaaatgctttcataccaggatgatgaaaatagacaacttactccaccagaaaacaac
aaaggagaggatacccggcactccccaaagaaaggatttctgtgctcctcctcactaggt
cgaagagcatcttttcacttagaatgtctgaaaagacagaaaaaccagggtgtagacgtc
tcacagaagacagttctgcctttgcatctggtacatcatcaggcattggcagtggcaggc
ctgagtcccctactccagcgaagccattcccccaccatgttctcccgactgtgtgctacg
ccccctgcgacaccctgtagccgtggctggccacaacagaccatcccgactctgcgcctc
gatggagcagagtccagcgagaaactcaacagcagcttcccatcaatacactgcagctct
cggtaccctgacgacagtggctgcagcagcccaaggagagccaggccagtctccctcacc
gtccccagtcagaccggagggagcaacaggcagtttcacggcagcgctggcagcctggtt
gaagcggtcttgatttcggaaggactgatgcagtttgctcaagatccaaagttcattgag
gtcacaacccaggagctcgcagacgcctgtgacatgacgatagaagagatggaaaatgca
gcagacaacattctcaatggtaacagcaagcagagccccaatggcaacctcttgcctttt
gttaactgcagggacccagggcaggacagtgcaggagaggaagaggaagaggtgcagaac
ccggattgtagaaaaagtcaggaggagctcaaggacagcaggatttatatcagcagcctg
tag

DBGET integrated database retrieval system