KEGG   Apteryx australis mantelli (brown kiwi): 106488410Help
Entry
106488410         CDS       T04298                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00500  Starch and sucrose metabolism
aam01100  Metabolic pathways
aam04910  Insulin signaling pathway
Module
aam_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106488410 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106488410 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aam01003]
    106488410 (GYS2)
Enzymes [BR:aam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     106488410 (GYS2)
Glycosyltransferases [BR:aam01003]
 Polysaccharide
  Storage polysaccharide
   106488410 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 106488410
NCBI-ProteinID: XP_013802743
LinkDB All DBs
Position
Un
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLPQWEDEDLPVEDLLLFEVSWEVTNKVGGIYTVIQTKAKITADEWG
ENYFLIGPYFEHNVKTQVEACESPNPALKKAMDTIKGQGCQVFFGRWLIEGTPYVLLFDI
GSAAWNLDRWKGEFWDVSNIGIPFHDREANDAVIFGSLTAWFLKELSCQFDDKPNIIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITAIEAEHMLKRNPDVATPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFSLEKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKSD
VTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQSVKEKFGEKLYNALLKGEIPDLNKI
LDRDDITIMKRAIFSTQRHCLPPVTTHNMTDDGNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPAAYGIYIVDRRFRSPDESCNQLTQILYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRTFPDKFEMEPSAPPKTEGFRFPRPSSVPPSPSVSQHSSPHHSEG
EDEDDDERYDEDEEAERDRQNIKSPFSLGVLPQGNKQQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggctagatcactgtctatgacctctcttaatggtcttcctcagtgggaggat
gaagacctgccagtggaggatttgttgctctttgaagtttcttgggaagtcaccaacaaa
gtgggaggcatttacactgtgatccagacaaaagccaaaattacagcagacgaatggggt
gaaaactatttcctgattggcccctattttgagcacaacgtgaagactcaggtggaagcc
tgtgagtctccaaaccccgcacttaagaaggcgatggacaccataaaaggccaagggtgt
caggtattttttggaagatggctgatagaaggcaccccatatgtcttattgtttgatata
ggatcagcagcctggaatctggacagatggaaaggcgaattttgggatgttagcaacata
gggatcccttttcatgaccgagaagccaacgatgctgtgatttttggatcactaacagcc
tggtttttaaaagagctttcctgtcagtttgatgacaagcccaacataattgcccacttt
catgaatggcaagcaggagtgggtttaatcctctctcgatctcagaaacttcctgttgcc
acaattttcactactcatgccactcttcttggaagatatctatgtgcagccagtatagat
ttctacaacaatcttgaccagtttgacattgacaaggaagcaggagagagacagatttac
catcgttactgtatggaacgggcatctgtacattgtgcccatgtgttcaccacagtctca
cagataacagctatagaagcagaacacatgcttaaaagaaatcctgatgttgccacccca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcagt
cttgaaaaaaccttatttttcttcattgctggaaggtacgagttttccaacaaaggagct
gatatgtttctagaggccttatcaagattaaactttctgctgagggttcataagagcgat
gttacagttgttgtgttcttcatcatgccagcaaagacaaacaatttcaatgtggaaagc
ctgaaaggacaagcagtccggaagcagctctgggatactgcacaatctgtgaaagaaaaa
tttggagagaaactctacaatgccttgttaaaaggagaaattccagacttgaacaagata
cttgaccgggatgatataaccattatgaaaagagccatcttttcaactcagcgacactgc
ctgcctccagtgaccacccacaacatgactgatgatggcaatgatccaatcctcaatacc
atccgacgcattggccttttcaacaatcggacagacagagtaaaggtgatcctacatcca
gagttcctttcttcaacaagtccattgctgcccttggattacgaagagtttgtcagaggc
tgccacctcggtgtatttccatcatactatgaaccctggggttacactccagctgaatgt
accgtgatgggcattcccagtgtgaccacaaacctttctggatttggctgtttcatgcag
gaacatgttgctgatccagctgcttatggcatttacatagttgacaggaggttccgctct
cctgatgagtcatgcaaccagctgactcagatcctgtatggattttgccagcagtcccgt
cgccagaggatcatccaaagaaaccgaaccgagaggctttcagacctgttggactggaga
tacttaggcaggtattacatgcatgccagacacttggccctcagcagaacattccctgac
aaatttgaaatggaaccaagtgctccgccaaagacggaaggtttcaggttccccaggcct
tcgtcagtgccaccatcaccctctgtctctcagcattccagccctcaccatagcgaaggg
gaagatgaagatgatgatgaaagatatgatgaggatgaggaagctgaaagggataggcaa
aacatcaagtctcccttttcccttggagtactgccacaaggaaacaagcagcagcatgga
gaatacaggaattga

DBGET integrated database retrieval system