KEGG   Apteryx mantelli mantelli (brown kiwi): 106488961
Entry
106488961         CDS       T04298                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04012  ErbB signaling pathway
aam04068  FoxO signaling pathway
aam04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106488961 (CDKN1B)
   04068 FoxO signaling pathway
    106488961 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106488961 (CDKN1B)
SSDB
Motif
Pfam: CDI US6
Other DBs
NCBI-GeneID: 106488961
NCBI-ProteinID: XP_013803532
LinkDB
Position
Un
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHRKEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGSSPDFYFRPPRLLKAVCKSAGHQSLDVNGNCQAVIFVG
SQGISEDTHCVDQKTGVSENQTDFAEQCTGQRKRPATDDSSPQNKRANTTEEEVSEDSPR
ASSVEQTPKKSSPRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtacgcatttctaatgggagccctaccctggagcgcatggaagccaggcag
tcggagtacccgaagccttcagcttgcaggaacctcttcgggccagtgaaccacgaagag
ttaaacagggacttaaagaagcaccgcaaggagatggaggaggcatgccagaggaagtgg
aatttcgatttccagaatcacaaacccctggaaggcaggtacgagtggcaagccgtggag
aagggaagctcgcccgacttctacttcaggcccccgaggctactcaaagccgtctgcaag
tccgccggccaccagagcttggatgtaaacgggaattgccaggccgtgatttttgttggt
tctcagggaatctcggaggacactcactgtgtagatcaaaagactggtgtttctgaaaat
cagacggactttgcagagcagtgcactgggcagaggaaaagacctgccactgacgattcc
tctcctcaaaataaaagagccaacacaacagaagaagaggtttcagaagactccccccgt
gcaagttcagtggagcaaacacctaagaaatcaagcccaagaagacatcaaacgtaa

DBGET integrated database retrieval system