KEGG   Apteryx mantelli mantelli (brown kiwi): 106488969
Entry
106488969         CDS       T04298                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04012  ErbB signaling pathway
aam04068  FoxO signaling pathway
aam04110  Cell cycle
aam04115  p53 signaling pathway
aam04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106488969
   04068 FoxO signaling pathway
    106488969
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106488969
   04115 p53 signaling pathway
    106488969
   04218 Cellular senescence
    106488969
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106488969
NCBI-ProteinID: XP_013803538
LinkDB
Position
Un
AA seq 153 aa
MERRPGKTTHARRNLFGPVDHEQLQQDFQHMLCSSIEGAQQKWNFDFLWDTPVEGLLQWE
ELEGHQVPAFYHSCVVGDTRRPLQHLNWPLGREDKIHHFVWVTLTEKPKTSKKTGGKRSP
EGKKRRQTSLTDYYSAKKRVKMNTQAVAKKSTS
NT seq 462 nt   +upstreamnt  +downstreamnt
atggagcggaggccggggaagacaacccacgcccggaggaacctctttggacccgtagac
cacgagcaactgcagcaggacttccagcacatgctgtgcagcagcatcgagggagcccag
cagaagtggaacttcgatttcctctgggacacaccagtcgaggggctcctgcagtgggaa
gagcttgagggtcaccaggtgcctgccttctaccacagctgtgtggtaggggatactcgg
agacccctgcagcacttgaactggcccctgggcagggaggacaagattcaccactttgtc
tgggtgacactgactgagaaacccaaaacttccaagaaaacagggggcaagaggagccca
gaagggaaaaaacgaagacagacatctctgacagattactactcagcaaagaagcgagtc
aaaatgaatacacaagctgttgcaaagaagtcaacttcttga

DBGET integrated database retrieval system