KEGG   Apteryx australis mantelli (brown kiwi): 106489325Help
Entry
106489325         CDS       T04298                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    106489325 (HDAC4)
Enzymes [BR:aam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106489325 (HDAC4)
Chromosome and associated proteins [BR:aam03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106489325 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 106489325
NCBI-ProteinID: XP_013803955
LinkDB All DBs
Position
Un
AA seq 1054 aa AA seqDB search
DVTTALPLQVAPTSVPMDLRLDHQFSMPVTEPTLREQQLQQELLALKQKQQIQRQILIAE
FQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLEQHRQEQELEKQHREQKL
QQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRFWYGKTQHSSLD
QSSPPQSGVSGTYNHPVLGMYDSKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRK
DGPVVTALKKRPLDVTDSACNSAPGSGPSSPNNSSNNISAENGITGSVTSIQAETSLAHR
LVNREGSVTQLPLYTSPSLPNITLGLPATGPSSGGSAQQDAERLALPTLQQRISLFPGTH
LTPYLSTTTLERDGGTAHNPLLQHMVLLEQPTAQTPLVTDWYLSGLPLHAQSLVGGERVS
PSIHKLRQHRPLGRTQSAPLPQNAQALQQLVIQQQHQQFLEKHKQQFQQQQLHINKIISK
PNEPARQHESHPEETEEELREHQALLEEPYSDRVASQKEAPGLANMVQVKQEPIESDEEE
AEPQQELEPGQRQAEQELLFRQQALLLEQQRIHQLRNYQASLEAAGVPVSFGGHRPLSRA
QSSPASATFPMSVQEPPTKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQ
ETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLTSMFVRLP
CGGVGVDSDTIWNEVHSSGAARLAVGCVIELVFKVATGELKNGFAVVRPPGHHAEESTPM
GFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDGNF
FPGSGAPDEVGTGAGVGFNVNMAFTGGLDPPMGDTEYLTAFRTVVMPIANEFAPDVVLVS
SGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRVVLALEGGHDLTAICDASEACVS
ALLGNELDPLPEKVFQQRANANAVHSMEKVIEIHSKYWHSLQRYASTVGYSLVEAQKCEN
EEAETVTAMASLSVGVKPAEKRPDDEPMEEEPPL
NT seq 3167 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtgaccacagcactgcccttgcaagttgcgccaacttcagtcccaatggatctcc
gcttggaccaccagttttccatgcccgtgacggaaccgacgctccgagagcagcagctcc
agcaggagcttctggcactcaagcagaagcagcagatccagaggcaaattctcatagccg
agtttcagaggcaacacgagcagctctcccggcagcatgaggctcagctgcacgagcaca
tcaaacagcagcaggagatgctggcaatgaagcatcagcaggaactcctggagcaccaga
ggaagttggagcaacaccggcaggagcaagagctggagaagcagcatcgagagcagaaac
ttcagcagctaaaaaacaaagagaaaggaaaagagagtgcggtggcaagcacagaagtaa
agatgaagttgcaagaattcgtcttaaataaaaagaaagctttggcacaccggaatctca
accattgtatatccagcgatcctcgcttctggtatgggaagacccaacacagttctctgg
accagagttccccaccccaaagcggagtatccggcacctacaaccaccctgtcctgggca
tgtacgattccaaagatgacttcccgctcagaaaaacagcatctgaacccaatctgaaac
tacgatccagactaaagcaaaaagtggctgaaagacggagcagccccctcttgcgcagaa
aagatggtccagtagttactgctcttaagaagcgtccactggatgtcacagactctgcat
gcaacagtgctcctggatctggtcccagctctccaaacaacagctccaacaacataagtg
ctgagaatggaattacaggatcggtcacgagtattcaagcagagaccagcctggctcaca
gactggtgaatcgtgaaggctccgtgacccagcttccgctctacacgtctccgtcgttgc
ccaacatcacgctagggctgcctgcgaccggcccttccagtggagggtcagcacagcagg
atgctgagaggcttgctctccccaccttacaacagcggatctctttgttccccggcaccc
acctcactccctacttgagcactacaacgctggaaagagatgggggaactgcacataacc
cccttctgcagcacatggtcttactggaacagccgactgcacaaactcccttggtcacag
actggtatctttcaggactgcccctccatgcacagtctctggttggtggagaacgggtct
ccccttcaatacacaaactccggcagcatcgcccgttggggcgcacgcagtctgctcccc
ttccccagaacgcccaggccctccagcagttagtgatccagcagcagcatcaacagtttt
tggagaaacataaacagcaattccagcaacagcaactacacatcaacaagatcatatcaa
aacctaatgagccagctcgccagcatgaaagccaccctgaggagacggaagaagagttac
gggaacaccaagcccttctggaggagccatacagcgacagagtcgcaagccagaaggagg
ccccagggctagccaacatggtgcaagtgaagcaagaacccattgagagcgatgaggagg
aagcagagccacagcaggagctggagcctgggcagaggcaggccgaacaggagctgctct
tccgtcagcaagccctcctgttggagcagcaacgcattcaccagctgagaaactaccagg
catcgctggaggcagctggcgtgccagtctcttttggagggcatcggcctctgtcccgtg
cacagtcctcgcctgcctcggccaccttccctatgtccgtacaggagccacccactaagc
caaggttcacaacaggccttgtgtacgacaccttgatgctgaaacatcagtgcacctgtg
gaaacacaaacagccacccagaacacgcggggcgaatccagagcatctggtcccggctcc
aggagacaggtctccgcggcaagtgcgagtgtattcgtggaagaaaagcaactctagaag
agctgcagacagttcactcggaagcccatacgctactgtacggcacaaaccctctgaaca
gacagaaactggacagcaagaaacttctaggttctctaacatcaatgtttgtcaggcttc
cttgtggcggtgttggggtcgacagcgacacaatttggaatgaagttcactcatctggtg
ctgctcgcctggctgtgggctgtgtcattgaacttgtttttaaagtagccaccggagaat
tgaagaatggatttgctgttgttcgacctccaggtcaccatgcagaagaaagcacaccca
tgggtttctgctactttaactccgtggcaattgcagccaagctgctccagcaaagactga
acgttagcaaaattcttatagtggactgggatgtacaccacggaaatggtactcagcaag
ctttctacaatgatcctaatgttctttatatttcactacatcgctatgatgatgggaact
tcttcccaggcagtggtgctcccgatgaggtcggcacaggagcaggagttggcttcaatg
ttaacatggcctttactggtggccttgatccaccgatgggagatacagaatacttaactg
ctttcagaacggtagtaatgcccattgccaatgaatttgccccagatgttgtgctggtgt
cgtctggttttgatgcagtggaaggccatcctacacctcttggaggatataatctatcag
caaaatgctttgggtacctgacgaagcagctgatgggcctggccggaggccgtgttgttc
tggccctcgaaggaggccatgacctgaccgccatttgcgacgcctcggaagcatgtgttt
ctgctttgctgggaaacgagcttgaccctcttccagaaaaggttttccagcagagagcaa
atgctaacgcagtccattccatggagaaagtcatcgagatacacagcaagtattggcatt
cactccagcgttatgcctccacagtggggtactccttggttgaggctcagaagtgcgaga
acgaagaagcggagactgtaacagccatggcatctttgtcggtaggcgtgaagccagctg
agaagagacctgatgatgaacccatggaagaggaacctcccctgtag

DBGET integrated database retrieval system