KEGG   Apteryx australis mantelli (brown kiwi): 106489973Help
Entry
106489973         CDS       T04298                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00010  Glycolysis / Gluconeogenesis
aam00030  Pentose phosphate pathway
aam00051  Fructose and mannose metabolism
aam00052  Galactose metabolism
aam01100  Metabolic pathways
aam01200  Carbon metabolism
aam01230  Biosynthesis of amino acids
aam03018  RNA degradation
Module
aam_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106489973 (PFKP)
   00030 Pentose phosphate pathway
    106489973 (PFKP)
   00051 Fructose and mannose metabolism
    106489973 (PFKP)
   00052 Galactose metabolism
    106489973 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106489973 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aam01009]
    106489973 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aam03019]
    106489973 (PFKP)
Enzymes [BR:aam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106489973 (PFKP)
Protein phosphatases and associated proteins [BR:aam01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106489973 (PFKP)
Messenger RNA biogenesis [BR:aam03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106489973 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106489973
NCBI-ProteinID: XP_013804715
LinkDB All DBs
Position
Un
AA seq 786 aa AA seqDB search
MDHQPKFFENLSGTGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVKAKVYFVYEGYQGMVD
GGDNIVEVSWESVSSILQVGGTVIGSARCKAFRTREGRLQAAYNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLEELAQKGKIDEEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWE
DSMCVKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEATPDTPACVVSLSGNQAVRLPLMECVQMTQEVQK
AMDEGRFVEAVRLRGRSFENNLNTYKLLSHKRPDAELPKTNFNVAILNVGAPAAGMNAAV
RAAVRVGITEGHKMFAVIDGFEGFARGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLE
KIADQMRTNNINALMVIGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFS
IGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEQ
FDIRELQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKEEGKVFANTDDSVCLLGMRRRN
LVFQPVAELKNETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMHSPKE
AETGAI
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagccgaagtttttcgagaacctctcgggcaccggcaaagccatcggcgtg
ctgaccagcggcggcgatgcccaaggtatgaatgctgctgtgcgcgcagtagtacgcatg
ggaatctatgttaaagccaaagtatattttgtttatgagggttaccaaggaatggttgat
ggaggtgataatattgttgaagtttcatgggaaagtgtttcaagtatcctgcaagtggga
ggtacagttattggcagtgcacgctgcaaagcctttcgtacccgggaaggccgcctgcaa
gcagcctacaacttggttcagagaggaatcactaatctttgtgtgattggtggagatggt
agcttaactggtgccaatctgtttcgtgaagaatggagtggacttctagaagaactggca
cagaaaggaaagattgatgaagaggctgttaaaaaatatgcttacctcaacattgtggga
atggttggatccatagacaatgacttctgtggcacggatatgaccataggtaccgattca
gccttgcacagaatcattgaagttgtggatgccatcatgacaactgctcagagccatcag
aggacatttgtcctggaggttatgggaagacactgtgggtatctagctcttgttagtgcc
ttagcctgtggtgcagattgggtatttattcctgaatacccaccagaagaaggatgggag
gattcaatgtgtgttaagctttcagagaatcgtgcacgaaagaaaaggctgaatattatt
attgtagctgaaggagctattgattgtcacaacaaacctataacatcagagaaggttaag
gatcttgtggttcagcggctcggttttgacacaagagtgactatcttgggtcatgtgcaa
agaggtggaaccccgtcagcttttgacagaattttggcaagccgtatgggtgtggaagct
gtacttgcccttctagaagctactccagatactcctgcctgtgttgtgtccctgtctgga
aaccaggcagtccgtctgcctttaatggagtgtgtgcagatgactcaagaagtacagaaa
gccatggatgaaggaagatttgttgaggctgtgaggcttcgtggaaggagctttgaaaac
aaccttaacacctacaaattactgtctcacaaaagaccagatgctgagcttccaaagact
aactttaacgtggcaattttaaatgttggtgctccagcagctggaatgaatgctgcagtg
agggctgcagtaagagttggcataactgaaggccataaaatgtttgctgtcattgatggt
tttgaaggttttgctagagggaagataaaggaaatcagctggggagatgttggaggctgg
actggtcaaggaggatcaattcttggtacaaaacgtactcttcctgcaaaatatttggag
aagatcgctgaccagatgcgcactaacaacattaatgcccttatggttattggtggattt
gaggcatacctcggacttctggaattgtcagcggcccgagagaaatatgacgaattctgt
gttccaatggttatggttcctgcaactgtatccaacaatgtaccgggttcagatttcagc
attggtgcagatactgctctgaacactataactgatacatgtgatcgcatcaaacagtca
gccagtggcaccaagcgtcgtgtattcatcattgagaccatgggtggttactgtggttac
ctggccaatatgggggcccttgcggcaggagctgatgctgcttatatctttgaagaacag
tttgatattcgagagctccaggctaacgtggaacacttgactgaaaaaatgaaaaccagt
attcagcgtggtctagtgctgagaaatgagaactccaatgagaattatacaactgacttc
atttatcagctgtattctgaagaaggaaaaggagtttttgactgtcgaaaaaatgtatta
ggacacatgcagcagggtggtgcaccttcgccatttgatagaaactttgggacaaaaatt
tctgcaaaagctatgcagtggatctccaaaaagctgaaagaaacataccgaaaagaagaa
ggaaaagtatttgccaatactgatgactcagtctgtttgctgggaatgcgtagacgcaac
cttgttttccaaccagtggctgagcttaagaatgaaacggactttgtacacaggattccc
aaggagcaatggtggctgaagctgcgaccactgatgaaaattctggccaagtacaagacc
agctacgatgtttcagactcaggccagctggagcatgttgctatgcacagcccaaaagaa
gcagaaactggagccatctaa

DBGET integrated database retrieval system