KEGG   Apteryx mantelli mantelli (brown kiwi): 106490172
Entry
106490172         CDS       T04298                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04010  MAPK signaling pathway
aam04020  Calcium signaling pathway
aam04144  Endocytosis
aam04510  Focal adhesion
aam04540  Gap junction
aam04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106490172 (PDGFRA)
   04020 Calcium signaling pathway
    106490172 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106490172 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106490172 (PDGFRA)
   04540 Gap junction
    106490172 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106490172 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aam01001]
    106490172 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:aam04090]
    106490172 (PDGFRA)
Enzymes [BR:aam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106490172 (PDGFRA)
Protein kinases [BR:aam01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   106490172 (PDGFRA)
CD molecules [BR:aam04090]
 Proteins
  106490172 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Gypsy Kinase-like
Other DBs
NCBI-GeneID: 106490172
NCBI-ProteinID: XP_013804993
LinkDB
Position
Un
AA seq 1087 aa
MGTSPRTFLILGCFFTGPFLTFCQLPLPTIVPSRNKMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGLYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPTIIPCRTSDPNAQVTLINSLDKAVYAFYDSKQGFIG
NFPAGSYTCKTTVEGVEFKSEEFLIYIIRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKHFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSILKLIRAKEEDRGYYTLVAENEDEIKRYTFSLLIQVPALILDL
VDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDSSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCMARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSMAESEVKN
LLSDDTSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacttccccaaggacattcctgatcctgggatgtttcttcacaggaccgtttcta
acattttgccagcttcctctgccgactattgttcccagtagaaacaaaatggtcgtacag
ctgaattccaatttcacactgaaatgctctggagacagcgaagtgagctggcagtaccca
gtgaccgagggaagccacaggatagacatcagacatgaagagaacaacagtggcctcttc
gtgacagtgctggaagtaggaaatgcctcagccgcgcatactggcttgtacgtttgctat
tacaatcacactcaagtggaggatggggaagtggaagggaaggacatctacatttatgta
cctgatccagacatgccttttgttccttccataccagaagatcagttcatcttagtagaa
gaaggcgatcctaccattatcccgtgtcgtacaagcgacccaaatgctcaagtgacttta
attaacagtttagacaaggctgtctatgccttctatgacagcaagcaaggcttcattggg
aattttcctgcaggctcatatacatgcaaaacaacagttgaaggtgtggagttcaagtct
gaagagttcctcatctatattataagagctacttcacagctgccggttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccattgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcctgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcacagaagctggtttacaccttgaccattcctgaggcg
tcagtgaaagacacaggggattatgaatgtactgctcggcacgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagtacatgacaaagggttcattcatctggagcctcag
tttagccctttggaagctgtcaacctacatgaagtcaaacattttgttgttgatgtgcag
gcatatccagctccaaaaatgtactggttgaaggacaatgtgactctgattgaaaatctt
actgagattgttactagttcaaacagagttcaggagacaaggtttcaaagtatattaaaa
ttgatccgggccaaggaagaagacagggggtactatactttggttgctgaaaatgaagat
gagattaaaagatacaccttctcattgctaatacaagttccagccttgatcttagacctg
gtggatgatcaccacggctcagcaggggggcagacggtgaggtgcttggcagaagggacc
ccgcttcctgacgtggaatggctggtttgcaaggacattaaaaaatgcagcaatgactcc
tcatggactcttttgactaacaatatctctgatatacacatggaagctcatctggatgag
aaaaatatggtggaaagccaggtgaccttccagaaggtagaggaaaccctggctgttcga
tgcatggcaagaaacgaccttggtgctgttactcgggaactgaagctcgtggctcccacc
ttgcgatcagaactaacagtggctgccgcagtcttagtacttttagtgattgtgataatt
tcactgattgtgctggtcatcatatggaaacagaagccaaggtatgagataagatggaga
gtcattgagtctattagccccgatggccatgaatacatttatgtggacccaatgcaactg
ccttatgactccagatgggagtttcctcgagatgggttagtgcttggtcgaatccttggt
tctggtgcctttggaaaagtagttgaagggactgcatatggactgagtcgctctcaacca
gtgatgaaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggca
cttatgtctgaattgaagataatgacacatctcgggccccacctgaatattgtgaatttg
cttggagcttgtacaaaatcaggtcctatttacatcatcactgaatactgcttttatggt
gatttggtgaactatttgcataagaacagggacaatttcctgagccgacacccggagaag
ccaaagaaggatttggacatctttgggatgaacccagctgatgaaagcacgagaagttat
gtaattttatcttttgaaaacactggagaatacatggacatgaaacaagctgatacaact
cagtatgtgccgatgctggaaaggaaggaaggctctaaatattcggatatccagagatct
gtgtatgatcgccctgcttcatacaagaagaaatctatggcagaatcagaagtcaaaaac
cttctttcagatgacacttcagaaggcctcagcctattggatttgttgagcttcacctat
caggttgcacggggaatggaattcttggcttctaaaaattgtgtacatcgtgacttggca
gctcgtaatgtccttctggctcaaggaaaaattgtgaagatctgtgactttggcctggct
agagacatcatgcatgattccaactatgtctccaagggcagcactttccttccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggcattctactgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gttgattctactttctacaataagataaagagtggctaccgaatggcaaagccagatcat
gctaccaatgaagtgtatgagatcatggtgaagtgctggaacagtgaaccagagaaaaga
ccttctttttaccatttgagtgaaattgtggagagcttgttgcctggggagtataaaaag
agctacgagaagattcatctggacttcctgaaaagtgatcacccagcagtcacacgcatg
agaggggactgtgacaatgcttacattggtgtcacctacaagaacgaagataagttaaag
gacagggagagtggatttgatgagcagagactgagtgctgacagcggatacatcatcccc
ctgcctgacattgaccctgtttctgaagacgagcttggcaaaagaaacaggcacagttcc
cagacatctgaagaaagtgccattgaaactggttccagtagctctacttttatcaagagg
gaggatgagaccattgaggacattgacatgatggatgacatcgggattgactcctcagac
ctggtagaggacagcttcctgtaa

DBGET integrated database retrieval system