KEGG   Apteryx mantelli mantelli (brown kiwi): 106490250
Entry
106490250         CDS       T04298                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04010  MAPK signaling pathway
aam04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106490250 (TGFA)
   04012 ErbB signaling pathway
    106490250 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF
Other DBs
NCBI-GeneID: 106490250
NCBI-ProteinID: XP_013805077
LinkDB
Position
Un
AA seq 91 aa
PPVAAAVRSHFNDCPDSHSQFCFHGTCRFLIQEEKPACICHFGYVGTRCEHADLLAVVAA
NQKKQTITALVVVSVVASVVLIVLLSGKKTL
NT seq 278 nt   +upstreamnt  +downstreamnt
gtcccccagtggccgcggcagtgcgatcccattttaacgactgtcctgactctcacagcc
agttctgcttccacgggacctgcaggtttctgattcaagaggagaagccagcatgcatat
gccactttgggtacgtcgggacgcgctgcgaacacgcggatctcctcgccgtggtcgctg
ccaatcagaagaagcagacaataactgccttggtggtggtgtcggtggtggcctcggttg
tgctcattgtgttgctgtcgggtaagaaaacactgtga

DBGET integrated database retrieval system