KEGG   Apteryx mantelli mantelli (brown kiwi): 106491102
Entry
106491102         CDS       T04298                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04068  FoxO signaling pathway
aam04217  Necroptosis
aam04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106491102 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106491102 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106491102 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aam03000]
    106491102 (STAT3)
Transcription factors [BR:aam03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    106491102 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 106491102
NCBI-ProteinID: XP_013806098
LinkDB
Position
Un
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHSEATDSGSAAPYLKTKFICVTPTSFS
NTIDLPMSPRTLDSLMQFGNNSEGAEANAGGQFESLTFDMELTPECASSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacactcggtacttggagcagcttcaccag
ctctacagtgacagctttcccatggagctccggcagttcttggctccatggattgagagc
caggactgggcgtacgctgccagcaaggagtcgcatgccacgctggtgttccacaacctg
ctgggggagatcgaccagcagtacagccgcttcctgcaggagtccaatgtactgtaccag
cacaacctgcgacggatcaagcagtttctgcagagccgatacctggagaagccaatggaa
atagcccgcatcgtggctcgctgcctgtgggaagagtcccggctccttcagacagctgca
actgcagcccaacaagggggacaggcaacacatccgacagcagctgtagtgacggaaaag
cagcaaatgctggagcagcatctgcaggatgtgaggaagagggtgcaggatctggagcag
aagatgaaagtggtggagaatctccaagatgactttgatttcaactacaagactttgaaa
agccaaggagacatgcaggatctgaatggaaacaatcagtcagtgacccggcagaaaatg
cagcaactggagcagatgctcacggcgctggaccaaatgcgaaggggtattgtgagtgag
ctggctggactgttgtcagccatggagtatgtgcagaagatgcttgcagatgaggagttg
gcagactggaaaagacggcagcaaatcgcctgcattggcggcccgcccaatatctgcctt
gaccggctggagaactggataacctctcttgcggaatcacagctacagacccggcagcag
atcaagaagctggaagagctgcagcagaaagtatcctacaagggtgaccccattgtccaa
caccggcccatgctggaggagcggattgtagagctattcaggaatctgatgaaaagcgct
tttgttgtggagaggcagccctgcatgccgatgcaccctgaccggcccttggtcatcaaa
accggcgtgcagttcaccaccaaagtcaggttattggtcaagttcccagagctgaactat
cagctgaaaattaaagtctgcattgacaaggactctggtgatgttgcagcccttaggggg
tcccggaagtttaacattctggggacaaataccaaggtgatgaacatggaagagtcgaac
aacggcagcctctcagcagagttcaagcacctgacactgcgggagcagcgatgtggcaat
ggaggaagagccaactgtgatgcctcactgatagtcactgaggagctgcacctcatcacc
tttgagacagaggtttatcaccaggggctgaagattgacctggagacccactcactgcca
gttgtggtcatctcaaacatctgccagatgcccaatgcctgggcgtccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagccccccatcgggacg
tgggaccaggtggcagaggtgctgagttggcagttctcctccaccaccaagcgtggtctc
agcattgagcagctgacaacactggcagaaaaacttctagggccaggtgtgaattactcc
ggctgtcaaatcacctgggccaagttctgcaaggagaacatggctggcaaaggcttctcc
ttctgggtctggctggacaacatcattgacttggtgaagaaatacatcctggcactgtgg
aatgaagggtacatcatggggttcatcagcaaggagcgggagcgagccatcctgagcacc
aagccaccaggaaccttcctgctacggttcagtgagagcagcaaggaaggtggcatcacc
ttcacctgggtggagaaggatatcagtgggaagacccagatccagtccgtggagccttac
accaagcagcagctaaacagcatgtcatttgcggagatcatcatgggctacaaaatcatg
gatgctaccaacatcctggtgtccccactggtgtatctgtacccggatatcccgaaggag
gaagcgtttgggaagtactgtcgccctgagagccaggaacactctgaagctacagactca
ggtagtgctgctccatacctgaagaccaagttcatctgtgtcacccccacctccttcagc
aacaccatcgacctgcccatgtccccacgcaccctggactcgctcatgcagtttggcaat
aacagcgagggagcagaggccaacgcaggaggccagtttgagtcgctgaccttcgacatg
gagctgaccccagagtgtgcttcttcaccaatgtga

DBGET integrated database retrieval system