KEGG   Apteryx australis mantelli (brown kiwi): 106491310Help
Entry
106491310         CDS       T04298                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00052  Galactose metabolism
aam00500  Starch and sucrose metabolism
aam01100  Metabolic pathways
aam04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106491310
   00500 Starch and sucrose metabolism
    106491310
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106491310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aam04147]
    106491310
Enzymes [BR:aam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106491310
Exosome [BR:aam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106491310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 BRX
Motif
Other DBs
NCBI-GeneID: 106491310
NCBI-ProteinID: XP_013806329
LinkDB All DBs
Position
Un
AA seq 777 aa AA seqDB search
MKSYQKLTTAVPQPAGCRLEEEGAAPKAACRGKLAPWWVGSGLLVAAVLLSAVTVWVLRQ
VSRGWHVPAPPPKCLLVPESHRFDCYPERRVVVTQELCESRGCCFIESSPPAGGKRGVPW
CFYPRDFPSYTLQSLNQTALGVVGLLVRREKAYYPRDIETLRLDVEFETDTRLHLKITDA
ANPRYEVPLEVPQAMKRAENPIYSVEFSRDPFGVLLRRRATGTVLLNTTVAPLIFADQFL
QVSTALPSPFLYGLGEHRSSLLHSLDWSTLTLWARDVAPTESFNLYGAHPFYLVMEQGGD
AHGVFLLNSNAMEVALQPAPALTWRTIGGVLDFYIFLGPDPNMVIQQYQQVIGFPAMPPL
WGLGFHLCRWGYGSSNETWQTVKAMRNYQIPQDAQWNDIDYMDGYRDFTFDPEKFASLPS
LVEDLHKHGQRYVMILDPGISSTNPHGSYWPFDEGLRRGLFINTTQGQPLIGQVWPGFTA
FADFSNQDAHQWWLENLQRFHAQVPFDGLWIDMNEPSNFMDGSEEGCPPGDLENPPYMPA
VLGDSLSAKTVCASAKQSISVHYNLHNLYGLMEAKATASALVQIRGKRPLVISRSTFPSQ
GRYSGHWLGDNQSQWKDMYYSIPGLLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGA
FYPFARNHNTQNEKAQDPTVFSPAARTAMKDVLLTRYSLLPFLYTLFHRAHLQGDTVARP
LFFEFPQDVTTYGMDRQFLWGRSLLVTPVLEPGVDSVTGYFPRGVWYDFYTVRSAAG
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtaccagaagctgacgacggccgtcccgcagccggcggggtgcaggctggag
gaggagggggccgccccgaaagccgcctgccgtgggaagctggccccgtggtgggtgggc
agcgggctgctggtggccgccgtgctgctgagcgccgtcaccgtgtgggtgctgcggcag
gtgtccaggggctggcatgtgcccgcgccgcctccgaaatgcctcctggtgcccgagagc
caccgcttcgactgctacccggagaggcgcgtggtggtgacccaggagctctgcgagagc
cgggggtgctgcttcatcgagagctccccgccggcgggcggcaagcggggggtgccctgg
tgcttctacccccgcgacttccccagctacacgctgcagagcctcaaccagaccgcgctg
ggcgtggtgggcctgctggtgcggagggagaaggcctactacccccgggacatcgagacg
ctgcgcctggacgtggagttcgagacggacacgcggctgcacctcaagataaccgatgct
gccaacccccggtacgaggttcccctcgaggttccccaggcgatgaagagagcggaaaat
cccatctacagcgtggagttctcccgggaccccttcggggtgctgctgcggcgcagggcg
acgggcacggtgctgctcaacaccaccgtggctcccttgatctttgccgaccagtttctc
caggtttctactgccctcccgtcgccgttcctctacgggctgggggagcatcgcagcagc
ctcctgcatagcctcgactggagcaccctgacgctgtgggcccgggacgttgctcccacg
gaatcgttcaacctctatggagctcaccccttctacctggtgatggagcagggtggagat
gctcacggtgttttcctcctcaacagcaacgcgatggaggtggctctgcagcctgcccca
gccctgacctggaggaccattgggggtgttttggatttttacatcttcctgggccctgat
cccaacatggtcatccagcagtaccagcaggtgataggtttcccggccatgccgcccctc
tggggactaggtttccacctctgccgctgggggtatggatcaagcaatgaaacctggcag
actgtgaaagccatgaggaattaccagatcccacaggatgcacagtggaatgacattgat
tatatggacggataccgggacttcacctttgaccccgagaagtttgcctccctcccctca
ctggtggaagacctccacaaacacggccagcgctacgttatgattttggatcccggtatc
agcagcaccaaccctcacggctcctactggccttttgatgaaggcttgagacggggattg
ttcataaacaccacccaagggcagccactgataggacaggtgtggcctggcttcactgcg
ttcgcagacttctccaaccaggatgcccatcagtggtggctggagaacctgcagcgtttc
catgcccaggtgcccttcgacggcctctggatcgacatgaatgagccatccaacttcatg
gatgggtctgaagaaggctgccccccaggagacctcgaaaacccaccgtacatgccagct
gtgctgggagattcactctctgcaaagacggtgtgtgcctcggcgaagcagagcatctca
gtgcactacaaccttcacaacctctacgggctgatggaagccaaagcaacagcgagtgcc
ttggtccagatccgaggaaagcgcccgctcgtcatctctcgctccaccttccccagccag
ggccgctactcagggcactggctgggcgacaaccagagccagtggaaggacatgtattac
tccatcccagggctgctgagcttcagcctctttgggatcccgctggttggggcagacatc
tgcggcttctctggcagcacctcggaggagctgtgcacccgctggatgcagctcggcgcc
ttctacccctttgcccggaaccacaacacccagaatgagaaggctcaagacccaacggtg
ttcagccccgcggctcggacggccatgaaggatgtgctactgacccgctactccttgctg
cccttcctctacacgcttttccaccgtgcccacctgcaaggagacaccgtcgcccggccc
ctgttcttcgagttccctcaggatgtgaccacgtacgggatggacaggcagttcctgtgg
ggacggagcctgctggtgacaccggtgctggagcccggggtggactcggtcacaggctat
ttcccccgaggcgtgtggtacgacttctacacggtgaggagcgctgcgggctga

DBGET integrated database retrieval system